Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

GDP-fucose protein O-fucosyltransferase 1 (O-fut1) Recombinant Protein | O-fut1 recombinant protein

Recombinant Drosophila melanogaster GDP-fucose protein O-fucosyltransferase 1 (O-fut1)

Gene Names
O-fut1; 4R6; AAF58290.1; CG12366; DmelCG12366; l(2)SH2 2260; l(2)SH2260; ntc; nti; O-fut; o-fut1; O-FUT1; Ofut-1; Ofut1; OFut1; OFUT1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
GDP-fucose protein O-fucosyltransferase 1 (O-fut1); Recombinant Drosophila melanogaster GDP-fucose protein O-fucosyltransferase 1 (O-fut1); O-fut1 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
24-402, Full length protein
Sequence
QLGGDPNGYLTYCPCMGRFGNQADHFLGSLAFAKALNRTLILPPWVEYRRGELRSRQVPFNTYFEVEPLKEYHRVITMADFMWHLADDIWPESERVSFCYKERYSLQQEKNDPDKPNCHAKDGNPFGPFWDTFHIDFVRSEFYAPLHFDVHHSNEAAKWQTKYPAESYPVLAFTGAPASFPVQLENCKLQRYLQWSQRYREASKDFIREQLPRGAFLGIHLRNGIDWVRACEHVKDSQHLFASPQCLGYKNERGALYPELCMPSKEAIIRQLKRTIKNVRQTQPDNEIKSVFVASDSNHMIGELNTALSRMGISVHKLPEDDPYLDLAILGQSNHFIGNCISSYSAFEKRERDVHGFPSYFWGFPKEKDRKHTNVHEEL
Sequence Length
379
Species
Drosophila melanogaster (Fruit fly)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
46,834 Da
NCBI Official Full Name
O-fucosyltransferase 1, isoform B
NCBI Official Synonym Full Names
O-fucosyltransferase 1
NCBI Official Symbol
O-fut1
NCBI Official Synonym Symbols
4R6; AAF58290.1; CG12366; DmelCG12366; l(2)SH2 2260; l(2)SH2260; ntc; nti; O-fut; o-fut1; O-FUT1; Ofut-1; Ofut1; OFut1; OFUT1
NCBI Protein Information
CG12366 gene product from transcript CG12366-RB
UniProt Protein Name
GDP-fucose protein O-fucosyltransferase 1
UniProt Gene Name
O-fut1
UniProt Synonym Gene Names
nti; O-FucT-1

Uniprot Description

Catalyzes the reaction that attaches fucose through an O-glycosidic linkage to a conserved serine or threonine residue found in the consensus sequence C2-X(4,5)-[S/T]-C3 of EGF domains, where C2 and C3 are the second and third conserved cysteines. Specifically uses GDP-fucose as donor substrate and proper disulfide pairing of the substrate EGF domains is required for fucose transfer. Plays a crucial role in Notch signaling. Initial fucosylation of Notch/N by POFUT1 generates a substrate for Fringe/Fng, an acetylglucosaminyltransferase that can then extend the fucosylation on the Notch EGF repeats. This extended fucosylation is required for optimal ligand binding and canonical NOTCH signaling induced by Delta/Dl or Serrate/Ser. Also required for the transport of Notch/N to the early endosome.

Research Articles on O-fut1

Similar Products

Product Notes

The O-fut1 o-fut1 (Catalog #AAA1291086) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 24-402, Full length protein. The amino acid sequence is listed below: QLGGDPNGYL TYCPCMGRFG NQADHFLGSL AFAKALNRTL ILPPWVEYRR GELRSRQVPF NTYFEVEPLK EYHRVITMAD FMWHLADDIW PESERVSFCY KERYSLQQEK NDPDKPNCHA KDGNPFGPFW DTFHIDFVRS EFYAPLHFDV HHSNEAAKWQ TKYPAESYPV LAFTGAPASF PVQLENCKLQ RYLQWSQRYR EASKDFIREQ LPRGAFLGIH LRNGIDWVRA CEHVKDSQHL FASPQCLGYK NERGALYPEL CMPSKEAIIR QLKRTIKNVR QTQPDNEIKS VFVASDSNHM IGELNTALSR MGISVHKLPE DDPYLDLAIL GQSNHFIGNC ISSYSAFEKR ERDVHGFPSY FWGFPKEKDR KHTNVHEEL. It is sometimes possible for the material contained within the vial of "GDP-fucose protein O-fucosyltransferase 1 (O-fut1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.