7,8-dihydro-8-oxoguanine triphosphatase (Nudt1) Recombinant Protein | Nudt1 recombinant protein
Recombinant Mouse 7,8-dihydro-8-oxoguanine triphosphatase (Nudt1)
Gene Names
Nudt1; Mth1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
7; 8-dihydro-8-oxoguanine triphosphatase (Nudt1); Recombinant Mouse 7; Nudt1 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
21-156, Full length protein
Sequence
GMKKRGFGAGRWNGFGGKVQEGETIEDGAKRELLEESGLSVDTLHKVGHISFEFVGSPELMDVHIFSADHVHGTPTESEEMRPQWFQLDQIPFADLWPDDSYWFPLLLQKKKFCGHFKFQDQDTILSYSLREVDSF
Sequence Length
136
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Nudt1 recombinant protein
Misincorporation of oxidized nucleoside triphosphates into DNA
RNA during replication and transcription can cause mutations that may result in carcinogenesis or neurodegeneration. This protein is an enzyme that hydrolyzes oxidized purine nucleoside triphosphates, such as 8-oxo-dGTP, 8-oxo-dATP, 2-hydroxy-dATP, and 2-hydroxy rATP, to monophosphates, thereby preventing misincorporation. The encoded protein is localized mainly in the cytoplasm, with some in the mitochondria, suggesting that it is involved in the sanitization of nucleotide pools both for nuclear and mitochondrial genomes. Several alternatively spliced transcript variants, some of which encode distinct isoforms, have been identified. Additional variants have been observed, but their full-length natures have not been determined. A single-nucleotide polymorphism that results in the production of an additional, longer isoform (p26) has been described.
RNA during replication and transcription can cause mutations that may result in carcinogenesis or neurodegeneration. This protein is an enzyme that hydrolyzes oxidized purine nucleoside triphosphates, such as 8-oxo-dGTP, 8-oxo-dATP, 2-hydroxy-dATP, and 2-hydroxy rATP, to monophosphates, thereby preventing misincorporation. The encoded protein is localized mainly in the cytoplasm, with some in the mitochondria, suggesting that it is involved in the sanitization of nucleotide pools both for nuclear and mitochondrial genomes. Several alternatively spliced transcript variants, some of which encode distinct isoforms, have been identified. Additional variants have been observed, but their full-length natures have not been determined. A single-nucleotide polymorphism that results in the production of an additional, longer isoform (p26) has been described.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
17,908 Da
NCBI Official Full Name
7,8-dihydro-8-oxoguanine triphosphatase
NCBI Official Synonym Full Names
nudix (nucleoside diphosphate linked moiety X)-type motif 1
NCBI Official Symbol
Nudt1
NCBI Official Synonym Symbols
Mth1
NCBI Protein Information
7,8-dihydro-8-oxoguanine triphosphatase
UniProt Protein Name
7,8-dihydro-8-oxoguanine triphosphatase
Protein Family
UniProt Gene Name
Nudt1
UniProt Synonym Gene Names
Mth1; Nudix motif 1
Uniprot Description
Antimutagenic. Acts as a sanitizing enzyme for oxidized nucleotide pools, thus suppressing cell dysfunction and death induced by oxidative stress. Hydrolyzes 8-oxo-dGTP, 8-oxo-dATP and 2-OH-dATP, thus preventing misincorporation of oxidized purine nucleoside triphosphates into DNA and subsequently preventing A:T to C:G and G:C to T:A transversions. Able to hydrolyze also the corresponding ribonucleotides, 2-OH-ATP, 8-oxo-GTP and 8-oxo-ATP. Does not play a role in U8 snoRNA decapping activity. Binds U8 snoRNA.
Research Articles on Nudt1
Similar Products
Product Notes
The Nudt1 nudt1 (Catalog #AAA949031) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 21-156, Full length protein. The amino acid sequence is listed below: GMKKRGFGAG RWNGFGGKVQ EGETIEDGAK RELLEESGLS VDTLHKVGHI SFEFVGSPEL MDVHIFSADH VHGTPTESEE MRPQWFQLDQ IPFADLWPDD SYWFPLLLQK KKFCGHFKFQ DQDTILSYSL REVDSF. It is sometimes possible for the material contained within the vial of "7,8-dihydro-8-oxoguanine triphosphatase (Nudt1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
