Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mitochondrial DNA base excision repair N-glycosylase 1 (NTG1) Recombinant Protein | NTG1 recombinant protein

Recombinant Saccharomyces cerevisiae Mitochondrial DNA base excision repair N-glycosylase 1 (NTG1)

Gene Names
NTG1; FUN33; ogg2; SCR1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Mitochondrial DNA base excision repair N-glycosylase 1 (NTG1); Recombinant Saccharomyces cerevisiae Mitochondrial DNA base excision repair N-glycosylase 1 (NTG1); NTG1 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
18-399, full length protein
Sequence
LVKTETGPESELLPEKRTKIKQEEVVPQPVDIDWVKSLPNKQYFEWIVVRNGNVPNRWATPLDPSILVTPASTKVPYKFQETYARMRVLRSKILAPVDIIGGSSIPVTVASKCGISKEQISPRDYRLQVLLGVMLSSQTKDEVTAMAMLNIMRYCIDELHSEEGMTLEAVLQINETKLDELIHSVGFHTRKAKYILSTCKILQDQFSSDVPATINELLGLPGVGPKMAYLTLQKAWGKIEGICVDVHVDRLTKLWKWVDAQKCKTPDQTRTQLQNWLPKGLWTEINGLLVGFGQIITKSRNLGDMLQFLPPDDPRSSLDWDLQSQLYKEIQQNIMSYPKWVKYLEGKRELNVEAEINVKHEEKTVEETMVKLENDISVKVED
Sequence Length
382
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
45,577 Da
NCBI Official Full Name
bifunctional N-glycosylase/AP lyase NTG1
NCBI Official Symbol
NTG1
NCBI Official Synonym Symbols
FUN33; ogg2; SCR1
NCBI Protein Information
bifunctional N-glycosylase/AP lyase NTG1
UniProt Protein Name
Endonuclease III homolog 1
Protein Family
UniProt Gene Name
NTG1
UniProt Synonym Gene Names
DNA glycosylase/AP lyase 1

Uniprot Description

Bifunctional DNA N-glycosylase with associated apurinic/apyrimidinic (AP) lyase function that catalyzes the first step in base excision repair (BER), the primary repair pathway for the repair of oxidative DNA damage. The DNA N-glycosylase activity releases the damaged DNA base from DNA by cleaving the N-glycosidic bond, leaving an AP site. The AP-lyase activity cleaves the phosphodiester bond 3' to the AP site by a beta-elimination. Primarily recognizes and repairs oxidative base damage of pyrimidines, but also purine-derived lesions, alkylation damage and cytosine photoproducts generated by UV irradiation as well as abasic sites. Has also 8-oxoguanine DNA glycosylase activity. The AP lyase can incise AP sites opposite all four bases. May also play a role in the regulation of mtDNA copy number by introducing a double-stranded break (DSB) at the mtDNA replication origin ori5, initiating the rolling-circle mtDNA replication.

Research Articles on NTG1

Similar Products

Product Notes

The NTG1 ntg1 (Catalog #AAA1049065) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 18-399, full length protein. The amino acid sequence is listed below: LVKTETGPES ELLPEKRTKI KQEEVVPQPV DIDWVKSLPN KQYFEWIVVR NGNVPNRWAT PLDPSILVTP ASTKVPYKFQ ETYARMRVLR SKILAPVDII GGSSIPVTVA SKCGISKEQI SPRDYRLQVL LGVMLSSQTK DEVTAMAMLN IMRYCIDELH SEEGMTLEAV LQINETKLDE LIHSVGFHTR KAKYILSTCK ILQDQFSSDV PATINELLGL PGVGPKMAYL TLQKAWGKIE GICVDVHVDR LTKLWKWVDA QKCKTPDQTR TQLQNWLPKG LWTEINGLLV GFGQIITKSR NLGDMLQFLP PDDPRSSLDW DLQSQLYKEI QQNIMSYPKW VKYLEGKREL NVEAEINVKH EEKTVEETMV KLENDISVKV ED. It is sometimes possible for the material contained within the vial of "Mitochondrial DNA base excision repair N-glycosylase 1 (NTG1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.