Cytosolic 5'-nucleotidase 1B (Nt5c1b) Recombinant Protein | Nt5c1b recombinant protein
Recombinant Mouse Cytosolic 5'-nucleotidase 1B (Nt5c1b)
Gene Names
Nt5c1b; AIRP; cN1B; CN-IB; 4921514H13Rik
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Cytosolic 5'-nucleotidase 1B (Nt5c1b); Recombinant Mouse Cytosolic 5'-nucleotidase 1B (Nt5c1b); Nt5c1b recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-573, Full length protein
Sequence
MSQTSLKHKKKNEPGMRYSKESLDAEKRKDSDKTGARLSTQGSQELPLHNTDSRGYVVRNQWSRTSRSPSTGAPSVDEPRSRNTAIKVEAPNSSTTSRTSSASPSQHETSPPPQTSEKSSIQQTPQNRPITQLESQPPTPPETEPNSRRTSAKMYTGSDPWAHRENREPRDLQLRDYAYSCDSREGMPKTREYPRTPPTEWKPYAQRRLQYGTSVDMEPEYISDGPQQRQRQQTEEDEVDEAYWTSVSMLYEKIPSCARPRPPKPKHAITIAVSSRALFNMVDDRKIYEEEGLEKYMEYQLTNENVILTPGPAFRFVKALQHVNSRLRDLYPDEQDLFDIVLMTNNHAQVGVRLINSVNHYGLLIDRFCLTGGKSPIGYLKAYLTNLYLSADSEKVQEAIKEGIASATMYAGAKDMAYCDTQLRVAFDGDAVLFSDESEHIAKDHGLDKFFQHETLFENKPLAQGPLKSFLEDLGKLQKKFYAKDERLLCPIRTYLVTARSAASSGARVLKTLRRWGLEIDEALFLAGAPKGPILVKIRPHIFFDDQMFHIESAQKFGTITAHVPYGIAQKRN
Sequence Length
573
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
62,945 Da
NCBI Official Full Name
cytosolic 5'-nucleotidase 1B isoform 1
NCBI Official Synonym Full Names
5'-nucleotidase, cytosolic IB
NCBI Official Symbol
Nt5c1b
NCBI Official Synonym Symbols
AIRP; cN1B; CN-IB; 4921514H13Rik
NCBI Protein Information
cytosolic 5'-nucleotidase 1B
UniProt Protein Name
Cytosolic 5'-nucleotidase 1B
Protein Family
UniProt Gene Name
Nt5c1b
UniProt Synonym Gene Names
Airp; cN1B; cN-IB
Uniprot Description
Dephosphorylates the 5' and 2'(3')-phosphates of deoxyribonucleotides. Helps to regulate adenosine levels.
Research Articles on Nt5c1b
1. Ecto-5'-nucleotidase mRNA levels were found to be diminished in both MT1 and MT1/2 knockout mice.
Similar Products
Product Notes
The Nt5c1b nt5c1b (Catalog #AAA1475475) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-573, Full length protein. The amino acid sequence is listed below: MSQTSLKHKK KNEPGMRYSK ESLDAEKRKD SDKTGARLST QGSQELPLHN TDSRGYVVRN QWSRTSRSPS TGAPSVDEPR SRNTAIKVEA PNSSTTSRTS SASPSQHETS PPPQTSEKSS IQQTPQNRPI TQLESQPPTP PETEPNSRRT SAKMYTGSDP WAHRENREPR DLQLRDYAYS CDSREGMPKT REYPRTPPTE WKPYAQRRLQ YGTSVDMEPE YISDGPQQRQ RQQTEEDEVD EAYWTSVSML YEKIPSCARP RPPKPKHAIT IAVSSRALFN MVDDRKIYEE EGLEKYMEYQ LTNENVILTP GPAFRFVKAL QHVNSRLRDL YPDEQDLFDI VLMTNNHAQV GVRLINSVNH YGLLIDRFCL TGGKSPIGYL KAYLTNLYLS ADSEKVQEAI KEGIASATMY AGAKDMAYCD TQLRVAFDGD AVLFSDESEH IAKDHGLDKF FQHETLFENK PLAQGPLKSF LEDLGKLQKK FYAKDERLLC PIRTYLVTAR SAASSGARVL KTLRRWGLEI DEALFLAGAP KGPILVKIRP HIFFDDQMFH IESAQKFGTI TAHVPYGIAQ KRN. It is sometimes possible for the material contained within the vial of "Cytosolic 5'-nucleotidase 1B (Nt5c1b), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
