Cytosolic 5'-nucleotidase 1B (NT5C1B) Recombinant Protein | NT5C1B recombinant protein
Recombinant Human Cytosolic 5'-nucleotidase 1B (NT5C1B)
Gene Names
NT5C1B; AIRP; CN1B; CN-IB
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Cytosolic 5'-nucleotidase 1B (NT5C1B); Recombinant Human Cytosolic 5'-nucleotidase 1B (NT5C1B); NT5C1B recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-610, Full length protein
Sequence
MSQTSLKQKKNEPGMRSSKESLEAEKRKESDKTGVRLSNQMRRAVNPNHSLRCCPFQGHSSCRRCLCAAEGTALGPCHTIRIYIHMCLLWEQGQQITMMRGSQESSLRKTDSRGYLVRSQWSRISRSPSTKAPSIDEPRSRNTSAKLPSSSTSSRTPSTSPSLHDSSPPPLSGQPSLQPPASPQLPRSLDSRPPTPPEPDPGSRRSTKMQENPEAWAQGIVREIRQTRDSQPLEYSRTSPTEWKSSSQRRGIYPASTQLDRNSLSEQQQQQREDEDDYEAAYWASMRSFYEKNPSCSRPWPPKPKNAITIALSSCALFNMVDGRKIYEQEGLEKYMEYQLTNENVILTPGPAFRFVKALQYVNARLRDLYPDEQDLFDIVLMTNNHAQVGVRLINSVNHYGLLIDRFCLTGGKDPIGYLKAYLTNLYIAADSEKVQEAIQEGIASATMFDGAKDMAYCDTQLRVAFDGDAVLFSDESEHFTKEHGLDKFFQYDTLCESKPLAQGPLKGFLEDLGRLQKKFYAKNERLLCPIRTYLVTARSAASSGARVLKTLRRWGLEIDEALFLAGAPKSPILVKIRPHIFFDDHMFHIEGAQRLGSIAAYGFNKKFSS
Sequence Length
610
Species
Human
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
68,022 Da
NCBI Official Full Name
cytosolic 5'-nucleotidase 1B isoform 1
NCBI Official Synonym Full Names
5'-nucleotidase, cytosolic IB
NCBI Official Symbol
NT5C1B
NCBI Official Synonym Symbols
AIRP; CN1B; CN-IB
NCBI Protein Information
cytosolic 5'-nucleotidase 1B
UniProt Protein Name
Cytosolic 5'-nucleotidase 1B
Protein Family
UniProt Gene Name
NT5C1B
UniProt Synonym Gene Names
AIRP; cN1B; cN-IB
NCBI Description
Cytosolic 5-prime nucleotidases, such as NT5C1B, catalyze production of adenosine, which regulates diverse physiologic processes (Sala-Newby and Newby, 2001 [PubMed 11690631]).[supplied by OMIM, Mar 2008]
Uniprot Description
Dephosphorylates the 5' and 2'(3')-phosphates of deoxyribonucleotides. Helps to regulate adenosine levels ().
Research Articles on NT5C1B
Similar Products
Product Notes
The NT5C1B nt5c1b (Catalog #AAA1301508) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-610, Full length protein. The amino acid sequence is listed below: MSQTSLKQKK NEPGMRSSKE SLEAEKRKES DKTGVRLSNQ MRRAVNPNHS LRCCPFQGHS SCRRCLCAAE GTALGPCHTI RIYIHMCLLW EQGQQITMMR GSQESSLRKT DSRGYLVRSQ WSRISRSPST KAPSIDEPRS RNTSAKLPSS STSSRTPSTS PSLHDSSPPP LSGQPSLQPP ASPQLPRSLD SRPPTPPEPD PGSRRSTKMQ ENPEAWAQGI VREIRQTRDS QPLEYSRTSP TEWKSSSQRR GIYPASTQLD RNSLSEQQQQ QREDEDDYEA AYWASMRSFY EKNPSCSRPW PPKPKNAITI ALSSCALFNM VDGRKIYEQE GLEKYMEYQL TNENVILTPG PAFRFVKALQ YVNARLRDLY PDEQDLFDIV LMTNNHAQVG VRLINSVNHY GLLIDRFCLT GGKDPIGYLK AYLTNLYIAA DSEKVQEAIQ EGIASATMFD GAKDMAYCDT QLRVAFDGDA VLFSDESEHF TKEHGLDKFF QYDTLCESKP LAQGPLKGFL EDLGRLQKKF YAKNERLLCP IRTYLVTARS AASSGARVLK TLRRWGLEID EALFLAGAPK SPILVKIRPH IFFDDHMFHI EGAQRLGSIA AYGFNKKFSS. It is sometimes possible for the material contained within the vial of "Cytosolic 5'-nucleotidase 1B (NT5C1B), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
