Melanoma-associated antigen G1 (Ndnl2) Recombinant Protein | Ndnl2 recombinant protein
Recombinant Mouse Melanoma-associated antigen G1 (Ndnl2)
Gene Names
Nsmce3; HCA4; Ndnl2; Mageg1; mage-g1; AI642138; BB044375; 5730494G16Rik
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Melanoma-associated antigen G1 (Ndnl2); Recombinant Mouse Melanoma-associated antigen G1 (Ndnl2); Ndnl2 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-279, full length protein
Sequence
MLQKPRGRGRPSTQADPERDWGGAGEEGPSTSRAAGGSSQGSRASLSAPTVGPRTQKQLELKVAELVQFLLIKDQKKIPIKRTDILKHVVGDYRDVYPNLLKLAAERLQYVFGYKLVELEPKSHSYILINMLEPVEADAEMRGDQGTPISGLLMIVLGLIFMKGNTITETEVWDFLRRLGVYPTKKHLIFGDPKKLITEDFVRQRYLEYRRIPHTDPVDYELQWGPRTNLETSKMKVLKFVAKVHNQDPKDWPTQYCEALADEESRARPATASAPATSS
Sequence Length
279
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Ndnl2 recombinant protein
This intronless gene encodes a member of the MAGE superfamily. The encoded protein is 76% identical to the mouse mage-g1 protein.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
31,460 Da
NCBI Official Full Name
non-structural maintenance of chromosomes element 3 homolog
NCBI Official Synonym Full Names
NSE3 homolog, SMC5-SMC6 complex component
NCBI Official Symbol
Nsmce3
NCBI Official Synonym Symbols
HCA4; Ndnl2; Mageg1; mage-g1; AI642138; BB044375; 5730494G16Rik
NCBI Protein Information
non-structural maintenance of chromosomes element 3 homolog
UniProt Protein Name
Non-structural maintenance of chromosomes element 3 homolog
UniProt Gene Name
Nsmce3
UniProt Synonym Gene Names
Mageg1; Ndnl2; Non-SMC element 3 homolog
Uniprot Description
Component of the SMC5-SMC6 complex, a complex involved in repair of DNA double-strand breaks by homologous recombination. The complex may promote sister chromatid homologous recombination by recruiting the SMC1-SMC3 cohesin complex to double-strand breaks. The complex is required for telomere maintenance via recombination in ALT (alternative lengthening of telomeres) cell lines and mediates sumoylation of shelterin complex (telosome) components which is proposed to lead to shelterin complex disassembly in ALT-associated PML bodies (APBs). In vitro enhances ubiquitin ligase activity of NSMCE1. Proposed to act through recruitment and/or stabilization of the Ubl-conjugating enzyme (E2) at the E3:substrate complex (). May be a growth suppressor that facilitates the entry of the cell into cell cycle arrest (PubMed:14593116).
Research Articles on Ndnl2
Similar Products
Product Notes
The Ndnl2 nsmce3 (Catalog #AAA1455997) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-279, full length protein. The amino acid sequence is listed below: MLQKPRGRGR PSTQADPERD WGGAGEEGPS TSRAAGGSSQ GSRASLSAPT VGPRTQKQLE LKVAELVQFL LIKDQKKIPI KRTDILKHVV GDYRDVYPNL LKLAAERLQY VFGYKLVELE PKSHSYILIN MLEPVEADAE MRGDQGTPIS GLLMIVLGLI FMKGNTITET EVWDFLRRLG VYPTKKHLIF GDPKKLITED FVRQRYLEYR RIPHTDPVDY ELQWGPRTNL ETSKMKVLKF VAKVHNQDPK DWPTQYCEAL ADEESRARPA TASAPATSS. It is sometimes possible for the material contained within the vial of "Melanoma-associated antigen G1 (Ndnl2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
