E3 SUMO-protein ligase NSE2 (nsmce2) Recombinant Protein | nsmce2 recombinant protein
Recombinant Xenopus laevis E3 SUMO-protein ligase NSE2 (nsmce2)
Gene Names
nsmce2.L; nse2; mms21; nsmce2
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
E3 SUMO-protein ligase NSE2 (nsmce2); Recombinant Xenopus laevis E3 SUMO-protein ligase NSE2 (nsmce2); nsmce2 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-238, Full length protein
Sequence
MSGRSAPVVSFSSVDNSLSSLKNCQGYLHTGMDITVSVALDLLETGCESTEVDAMESVMLEYSAMERDLKQYIHAVEETVQKLRREQMEQVPDLQSLVQEKYATIQKKNDDEDLKKNDRFVQFKDQLREMRKQMGEKEEGDAAFENVDEDIAVLPSQQNLTCPITQMEMTNPVKNKVCGHTYEKEAIERMIQDRHQKKKRVKCPKVGCVHSDMQISDLVPDTALKRTIDILNKQKGRH
Sequence Length
238
Species
Xenopus laevis (African clawed frog)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
27,226 Da
NCBI Official Full Name
E3 SUMO-protein ligase NSE2
NCBI Official Synonym Full Names
NSE2/MMS21 homolog, SMC5-SMC6 complex SUMO ligase L homeolog
NCBI Official Symbol
nsmce2.L
NCBI Official Synonym Symbols
nse2; mms21; nsmce2
NCBI Protein Information
E3 SUMO-protein ligase NSE2
UniProt Protein Name
E3 SUMO-protein ligase NSE2
Protein Family
UniProt Gene Name
nsmce2
UniProt Synonym Gene Names
mms21; Non-SMC element 2 homolog
Uniprot Description
E3 SUMO-protein ligase component of the SMC5-SMC6 complex, a complex involved in repair of DNA double-strand breaks by homologous recombination. Is not be required for the stability of the complex. The complex may promote sister chromatid homologous recombination by recruiting the SMC1-SMC3 cohesin complex to double-strand breaks. The complex is required for telomere maintenance via recombination and mediates sumoylation of shelterin complex (telosome) components. Required for recruitment of telomeres to PML nuclear bodies. SUMO protein-ligase activity is required for the prevention of DNA damage-induced apoptosis by facilitating DNA repair. Required for sister chromatid cohesion during prometaphase and mitotic progression ().
Similar Products
Product Notes
The nsmce2 nsmce2 (Catalog #AAA1396284) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-238, Full length protein. The amino acid sequence is listed below: MSGRSAPVVS FSSVDNSLSS LKNCQGYLHT GMDITVSVAL DLLETGCEST EVDAMESVML EYSAMERDLK QYIHAVEETV QKLRREQMEQ VPDLQSLVQE KYATIQKKND DEDLKKNDRF VQFKDQLREM RKQMGEKEEG DAAFENVDED IAVLPSQQNL TCPITQMEMT NPVKNKVCGH TYEKEAIERM IQDRHQKKKR VKCPKVGCVH SDMQISDLVP DTALKRTIDI LNKQKGRH. It is sometimes possible for the material contained within the vial of "E3 SUMO-protein ligase NSE2 (nsmce2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
