Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Genome polyprotein Recombinant Protein | YFVgp1 recombinant protein

Recombinant Yellow fever virus Genome polyprotein

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Genome polyprotein; Recombinant Yellow fever virus Genome polyprotein; Recombinant Genome polyprotein; Genome polyprotein Cleaved into the following 14 chains: 1. Capsid protein C; Core protein prM Peptide pr Small envelope protein M; Matrix protein Envelope protein E Non-structural protein 1; NS1 Non-structural protein 2A;; YFVgp1 recombinant protein
Ordering
For Research Use Only!
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
286-778. Partial, provide the Envelope protein E Chain
Sequence
AHCIGITDRDFIEGVHGGTWVSATLEQDKCVTVMAPDKPSLDISLETVAIDRPAEVRKVCYNAVLTHVKINDKCPSTGEAHLAEENEGDNACKRTYSDRGWGNGCGLFGKGSIVACAKFTCAKSMSLFEVDQTKIQYVIRAQLHVGAKQENWNTDIKTLKFDALSGSQEVEFIGYGKATLECQVQTAVDFGNSYIAEMETESWIVDRQWAQDLTLPWQSGSGGVWREMHHLVEFEPPHAATIRVLALGNQEGSLKTALTGAMRVTKDTNDNNLYKL HGGHVSCRVKLSALTLKGTSYKICTDKMFFVKNPTDTGHGTVVMQVKVSKGAPCRIPVIVADDLTAAINKGILVTVNPIASTNDDEVLIEVNPPFGDSYIIVGRGDSRLTYQWHKEGSSIGKLFTQTMKGVERLAVMGDTAWDFSSAGGFFTSVGKGIHTVFGSAFQGLFGGLNWITKVIMGAVLIWVGINTRNMTMSMSMILVGVIMMFLSLGVGA
Sequence Length
778
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Yellow fever virus (strain 17D vaccine) (YFV)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
Product Categories/Family for YFVgp1 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
379,518 Da
NCBI Official Full Name
polyprotein
NCBI Official Symbol
YFVgp1
NCBI Protein Information
polyprotein precursor; core protein C; anchored core protein C; M protein precursor; matrix protein M; envelope protein; non-structural protein NS1; non-structural protein NS2a; non-structural protein NS2b; non-structural protein NS3; non-structural protein NS4a; 2K protein; non-structural protein NS4b; RNA-dependent RNA polymerase
UniProt Protein Name
Genome polyprotein
Protein Family
UniProt Gene Name
NS1
UniProt Synonym Gene Names
NS2A; NS2A-alpha; NS4A; NS4B
UniProt Entry Name
POLG_YEFV1

Uniprot Description

Function: Capsid protein C self-assembles to form an icosahedral capsid about 30 nm in diameter. The capsid encapsulates the genomic RNA

By similarity. Ref.14 Ref.18 Ref.27 Ref.28 Ref.29prM acts as a chaperone for envelope protein E during intracellular virion assembly by masking and inactivating envelope protein E fusion peptide. prM is matured in the last step of virion assembly, presumably to avoid catastrophic activation of the viral fusion peptide induced by the acidic pH of the trans-Golgi network. After cleavage by host furin, the pr peptide is released in the extracellular medium and small envelope protein M and envelope protein E homodimers are dissociated

By similarity. Ref.14 Ref.18 Ref.27 Ref.28 Ref.29Envelope protein E binding to host cell surface receptor is followed by virus internalization through clathrin-mediated endocytosis. Envelope protein E is subsequently involved in membrane fusion between virion and host late endosomes. Synthesized as a homodimer with prM which acts as a chaperone for envelope protein E. After cleavage of prM, envelope protein E dissociate from small envelope protein M and homodimerizes

By similarity. Ref.14 Ref.18 Ref.27 Ref.28 Ref.29Non-structural protein 1 is involved in virus replication and regulation of the innate immune response

By similarity. Ref.14 Ref.18 Ref.27 Ref.28 Ref.29Non-structural protein 2A may be involved viral RNA replication and capsid assembly

Potential. Ref.14 Ref.18 Ref.27 Ref.28 Ref.29Non-structural protein 2B is a required cofactor for the serine protease function of NS3

By similarity. Ref.14 Ref.18 Ref.27 Ref.28 Ref.29Serine protease NS3 displays three enzymatic activities: serine protease, NTPase and RNA helicase. NS3 serine protease, in association with NS2B, performs its autocleavage and cleaves the polyprotein at dibasic sites in the cytoplasm: C-prM, NS2A-NS2B, NS2B-NS3, NS3-NS4A, NS4A-2K and NS4B-NS5. NS3 RNA helicase binds RNA and unwinds dsRNA in the 3' to 5' direction

By similarity. Ref.14 Ref.18 Ref.27 Ref.28 Ref.29Non-structural protein 4A induces host endoplasmic reticulum membrane rearrangements leading to the formation of virus-induced membranous vesicles hosting the dsRNA and polymerase, functioning as a replication complex. NS4A might also regulate the ATPase activity of the NS3 helicase

By similarity. Ref.14 Ref.18 Ref.27 Ref.28 Ref.29Peptide 2k functions as a signal peptide for NS4B and is required for the interferon antagonism activity of the latter

By similarity. Ref.14 Ref.18 Ref.27 Ref.28 Ref.29Non-structural protein 4B inhibits interferon (IFN)-induced host STAT1 phosphorylation and nuclear translocation, thereby preventing the establishment of cellular antiviral state by blocking the IFN-alpha/beta pathway

By similarity. Ref.14 Ref.18 Ref.27 Ref.28 Ref.29RNA-directed RNA polymerase NS5 replicates the viral (+) and (-) genome, and performs the capping of genomes in the cytoplasm. NS5 methylates viral RNA cap at guanine N-7 and ribose 2'-O positions. Besides its role in genome replication, also prevents the establishment of cellular antiviral state by blocking the interferon-alpha/beta (IFN-alpha/beta) signaling pathway

By similarity. Ref.14 Ref.18 Ref.27 Ref.28 Ref.29

Catalytic activity: Selective hydrolysis of -Xaa-Xaa-|-Yaa- bonds in which each of the Xaa can be either Arg or Lys and Yaa can be either Ser or Ala.Nucleoside triphosphate + RNA(n) = diphosphate + RNA(n+1).NTP + H2O = NDP + phosphate.ATP + H2O = ADP + phosphate.S-adenosyl-L-methionine + G(5')pppR-RNA = S-adenosyl-L-homocysteine + m7G(5')pppR-RNA.S-adenosyl-L-methionine + m7G(5')pppR-RNA = S-adenosyl-L-homocysteine + m7G(5')pppRm-RNA.

Subunit structure: Capsid protein C forms homodimers. prM and envelope protein E form heterodimers in the endoplasmic reticulum and Golgi. In immature particles, there are 60 icosaedrally organized trimeric spikes on the surface. Each spike consists of three heterodimers of envelope protein M precursor (prM) and envelope protein E. NS1 forms homodimers as well as homohexamers when secreted. NS1 may interact with NS4A. NS3 and NS2B form a heterodimer. NS3 is the catalytic subunit, whereas NS2B strongly stimulates the latter, acting as a cofactor. In the absence of the NS2B, NS3 protease is unfolded and inactive. NS3 interacts with unphosphorylated NS5; this interaction stimulates NS5 guanylyltransferase activity

By similarity. Ref.20 Ref.25

Subcellular location: Capsid protein C: Virion

Potential Ref.26. Peptide pr: Secreted. Small envelope protein M: Virion membrane; Multi-pass membrane protein

Potential. Host endoplasmic reticulum membrane; Multi-pass membrane protein

Potential Ref.26. Envelope protein E: Virion membrane; Multi-pass membrane protein

Potential. Host endoplasmic reticulum membrane; Multi-pass membrane protein

Potential Ref.26. Non-structural protein 1: Secreted. Host endoplasmic reticulum membrane; Peripheral membrane protein; Lumenal side Ref.26. Non-structural protein 2A-alpha: Host endoplasmic reticulum membrane; Multi-pass membrane protein

Potential Ref.26. Non-structural protein 2A: Host endoplasmic reticulum membrane; Multi-pass membrane protein

Potential Ref.26. Serine protease subunit NS2B: Host endoplasmic reticulum membrane; Peripheral membrane protein; Cytoplasmic side Ref.26. Serine protease NS3: Host endoplasmic reticulum membrane; Peripheral membrane protein; Cytoplasmic side

By similarity. Note: Remains non-covalently associated to NS3 protease

By similarity. Ref.26Non-structural protein 4A: Host endoplasmic reticulum membrane; Multi-pass membrane protein

By similarity Ref.26. Note: Located in RE-associated vesicles hosting the replication complex. Ref.26Non-structural protein 4B: Host endoplasmic reticulum membrane; Multi-pass membrane protein

By similarity Ref.26. RNA-directed RNA polymerase NS5: Host endoplasmic reticulum membrane; Peripheral membrane protein; Cytoplasmic side

By similarity. Host nucleus

By similarity. Note: Located in RE-associated vesicles hosting the replication complex. Ref.26

Domain: Transmembrane domains of the small envelope protein M and envelope protein E contains an endoplasmic reticulum retention signals.

Post-translational modification: Specific enzymatic cleavages in vivo yield mature proteins. The nascent protein C contains a C-terminal hydrophobic domain that act as a signal sequence for translocation of prM into the lumen of the ER. Mature protein C is cleaved at a site upstream of this hydrophobic domain by NS3. prM is cleaved in post-Golgi vesicles by a host furin, releasing the mature small envelope protein M, and peptide pr. Non-structural protein 2A-alpha, a C-terminally truncated form of non-structural protein 2A, results from partial cleavage by NS3. Specific enzymatic cleavages in vivo yield mature proteins Peptide 2K acts as a signal sequence and is removed from the N-terminus of NS4B by the host signal peptidase in the ER lumen. Signal cleavage at the 2K-4B site requires a prior NS3 protease-mediated cleavage at the 4A-2K site

By similarity. Ref.13RNA-directed RNA polymerase NS5 is phosphorylated on serines residues. This phosphorylation may trigger NS5 nuclear localization. Ref.19Envelope protein E and non-structural protein 1 are N-glycosylated.

Sequence similarities: In the N-terminal section; belongs to the class I-like SAM-binding methyltransferase superfamily. mRNA cap 0-1 NS5-type methyltransferase family.Contains 1 helicase ATP-binding domain.Contains 1 helicase C-terminal domain.Contains 1 mRNA cap 0-1 NS5-type MT domain.Contains 1 peptidase S7 domain.Contains 1 RdRp catalytic domain.

Research Articles on YFVgp1

Similar Products

Product Notes

The YFVgp1 ns1 (Catalog #AAA1047663) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 286-778. Partial, provide the Envelope protein E Chain. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the YFVgp1 ns1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: AHCIGITDRD FIEGVHGGTW VSATLEQDKC VTVMAPDKPS LDISLETVAI DRPAEVRKVC YNAVLTHVKI NDKCPSTGEA HLAEENEGDN ACKRTYSDRG WGNGCGLFGK GSIVACAKFT CAKSMSLFEV DQTKIQYVIR AQLHVGAKQE NWNTDIKTLK FDALSGSQEV EFIGYGKATL ECQVQTAVDF GNSYIAEMET ESWIVDRQWA QDLTLPWQSG SGGVWREMHH LVEFEPPHAA TIRVLALGNQ EGSLKTALTG AMRVTKDTND NNLYKL HG GHVSCRVKLS ALTLKGTSYK ICTDKMFFVK NPTDTGHGTV VMQVKVSKGA PCRIPVIVAD DLTAAINKGI LVTVNPIAST NDDEVLIEVN PPFGDSYIIV GRGDSRLTYQ WHKEGSSIGK LFTQTMKGVE RLAVMGDTAW DFSSAGGFFT SVGKGIHTVF GSAFQGLFGG LNWITKVIMG AVLIWVGINT RNMTMSMSMI LVGVIMMFLS LGVGA . It is sometimes possible for the material contained within the vial of "Genome polyprotein, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.