Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-PAGE

Ribosyldihydronicotinamide dehydrogenase Recombinant Protein | Nqo2 recombinant protein

Recombinant Rat Ribosyldihydronicotinamide dehydrogenase

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Ribosyldihydronicotinamide dehydrogenase; Recombinant Rat Ribosyldihydronicotinamide dehydrogenase; NRH dehydrogenase [quinone] 2; NRH:quinone oxidoreductase 2; Quinone reductase 2; QR2; Nqo2 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-231aa; Full Length
Sequence
MAGKKVLLVYAHQEPKSFNGSMKQVAVEELSKQGCTVTVSDLYTMNFEPRATRNDVTGALSNPEVFKYGIEAYEAYKKKALTSDILEEQRKVQEADLVIFQFPLYWFSVPAILKGWMDRVLCQGFAFDVPGFYDSGFLKDKLALLSFTTGGTAEMYTKAGVNGDFRYFLWPLQHGTLHFCGFKVLAPQISFGPEVSSEEQRKVMLASWVQRLKSIWKEEPIHCTPSWYFQG
Sequence Length
231
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

SDS-PAGE
Related Product Information for Nqo2 recombinant protein
The enzyme apparently serves as a quinone reductase in connection with conjugation reactions of hydroquinones involved in detoxification pathways as well as in biosynthetic processes such as the vitamin K-dependent gamma-carboxylation of glutamate residues in prothrombin synthesis.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
28.3 kDa
NCBI Official Full Name
ribosyldihydronicotinamide dehydrogenase
NCBI Official Synonym Full Names
NAD(P)H dehydrogenase, quinone 2
NCBI Official Symbol
Nqo2
NCBI Protein Information
ribosyldihydronicotinamide dehydrogenase [quinone]
UniProt Protein Name
Ribosyldihydronicotinamide dehydrogenase [quinone]
UniProt Gene Name
Nqo2
UniProt Synonym Gene Names
QR2
UniProt Entry Name
NQO2_RAT

NCBI Description

mouse homolog catalyzes the reduction of quinones and quinone derivatives; may protect against development of myelogenous hyperplasia , may contribute to menadione mediated hepatic toxicity [RGD, Feb 2006]

Uniprot Description

The enzyme apparently serves as a quinone reductase in connection with conjugation reactions of hydroquinones involved in detoxification pathways as well as in biosynthetic processes such as the vitamin K-dependent gamma-carboxylation of glutamate residues in prothrombin synthesis.

Research Articles on Nqo2

Similar Products

Product Notes

The Nqo2 nqo2 (Catalog #AAA1457769) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-231aa; Full Length. The amino acid sequence is listed below: MAGKKVLLVY AHQEPKSFNG SMKQVAVEEL SKQGCTVTVS DLYTMNFEPR ATRNDVTGAL SNPEVFKYGI EAYEAYKKKA LTSDILEEQR KVQEADLVIF QFPLYWFSVP AILKGWMDRV LCQGFAFDVP GFYDSGFLKD KLALLSFTTG GTAEMYTKAG VNGDFRYFLW PLQHGTLHFC GFKVLAPQIS FGPEVSSEEQ RKVMLASWVQ RLKSIWKEEP IHCTPSWYFQ G. It is sometimes possible for the material contained within the vial of "Ribosyldihydronicotinamide dehydrogenase, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.