Nucleophosmin (Npm1) Recombinant Protein | Npm1 recombinant protein

Recombinant Mouse Nucleophosmin (Npm1)

Cat. Num. AAA1366239

• Gene Names: Npm1; B23; Npm; NO38
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Nucleophosmin (Npm1); Recombinant Mouse Nucleophosmin (Npm1); Nucleophosmin; NPM; Nucleolar phosphoprotein B23; Nucleolar protein NO38; Numatrin; Npm1 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-292aa; Full Length
• Sequence: MEDSMDMDMSPLRPQNYLFGCELKADKDYHFKVDNDENEHQLSLRTVSLGAGAKDELHIVEAEAMNYEGSPIKVTLATLKMSVQPTVSLGGFEITPPVVLRLKCGSGPVHISGQHLVAVEEDAESEDEDEEDVKLLGMSGKRSAPGGGNKVPQKKVKLDEDDEDDDEDDEDDEDDDDDDFDEEETEEKVPVKKSVRDTPAKNAQKSNQNGKDLKPSTPRSKGQESFKKQEKTPKTPKGPSSVEDIKAKMQASIEKGGSLPKVEAKFINYVKNCFRMTDQEAIQDLWQWRKSL
• Sequence Length: 292

• Species: Mus musculus (Mouse)
• Production Note: Special Offer: The E Coli host-expressed protein is manufactured from a stock plasmid containing the protein gene. E Colihost-expressed protein is stocked in different unit sizes ranging from as small as 10 ug to as large as 1 mg. Bulk inventory is also available. The E Coli host-expressed protein has been ordered over and over again by researchers and has stood the test of time as both a robust protein and important target for the research community. It is part of our new program to make our most popular protein targets and corresponding hosts available in expanded unit sizes and with a quick processing time. Select E Coli host-expressed protein for the fastest delivery among all hosts. Please contact our technical support team or email to [email protected] for more details.
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

SDS-Page

Related Product Information for Npm1 recombinant protein

Involved in diverse cellular processes such as ribosome biogenesis, centrosome duplication, protein chaperoning, histone assembly, cell proliferation, and regulation of tumor suppressors p53/TP53 and ARF. Binds ribosome presumably to drive ribosome nuclear export. Associated with nucleolar ribonucleoprotein structures and bind single-stranded nucleic acids. Acts as a chaperonin for the core histones H3, H2B and H4. Stimulates APEX1 endonuclease activity on apurinic/apyrimidinic (AP) double-stranded DNA but inhibits APEX1 endonuclease activity on AP single-stranded RNA. May exert a control of APEX1 endonuclease activity within nucleoli devoted to repair AP on rDNA and the removal of oxidized rRNA molecules. In concert with BRCA2, regulates centrosome duplication. Regulates centriole duplication: phosphorylation by PLK2 is able to trigger centriole replication. Negatively regulates the activation of EIF2AK2/PKR and suppresses apoptosis through inhibition of EIF2AK2/PKR autophosphorylation. Antagonizes the inhibitory effect of ATF5 on cell proliferation and relieves ATF5-induced G2/M blockade.

Product Categories/Family for Npm1 recombinant protein

Epigenetics and Nuclear Signaling

NCBI and Uniprot Product Information

• NCBI GI #: 6679108
• NCBI GeneID: 18148
• NCBI Accession #: NP_032748.1
• NCBI GenBank Nucleotide #: NM_008722.3
• UniProt Accession #: Q61937
• Molecular Weight: 48.6 kDa
• NCBI Official Full Name: nucleophosmin isoform 1
• NCBI Official Synonym Full Names: nucleophosmin 1
• NCBI Official Symbol: Npm1
• NCBI Official Synonym Symbols: B23; Npm; NO38
• NCBI Protein Information: nucleophosmin; numatrin; nucleolar protein NO38; nucleolar phosphoprotein B23
• UniProt Protein Name: Nucleophosmin
• Protein Family: Nucleophosmin
• UniProt Gene Name: Npm1
• UniProt Synonym Gene Names: NPM
• UniProt Entry Name: NPM_MOUSE

Uniprot Description

NPM1: a nucleolar protein associated with nucleolar ribonucleoprotein structures and that binds single-stranded nucleic acids. Is a major component of template activating factor (TAF)-III. It plays a role in controlling centrosome duplication, and may function in the assembly and/or transport of the ribosome. Two alternatively spliced isoforms have been described.

Protein type: RNA-binding; Nucleolus; Oncoprotein; Translation

Cellular Component: centrosome; small ribosomal subunit; granular component; focal adhesion; cell; spindle pole centrosome; ribonucleoprotein complex; cytosol; nucleoplasm; cytoskeleton; membrane; cytoplasm; nucleolus; nuclear speck; intracellular; nucleus; large ribosomal subunit

Molecular Function: protein homodimerization activity; protein kinase inhibitor activity; histone binding; RNA binding; unfolded protein binding; transcription coactivator activity; protein kinase binding; ribosomal large subunit binding; rRNA binding; NF-kappaB binding; protein binding; phosphatidylinositol-3,4,5-triphosphate binding; enzyme binding; DNA binding; nucleic acid binding; protein heterodimerization activity; Tat protein binding; ribosomal small subunit binding

Biological Process: positive regulation of catalytic activity; positive regulation of DNA metabolic process; regulation of centriole replication; positive regulation of translation; regulation of cell cycle; centrosome cycle; nucleocytoplasmic transport; ribosomal large subunit biogenesis and assembly; ribosomal large subunit export from nucleus; regulation of DNA damage response, signal transduction by p53 class mediator; activation of NF-kappaB transcription factor; negative regulation of cell proliferation; protein localization; regulation of neuron apoptosis; positive regulation of cell proliferation; response to stress; cell growth; protein homooligomerization; ribosomal small subunit export from nucleus; protein destabilization; cell aging; DNA repair; positive regulation of cellular biosynthetic process; protein oligomerization; nucleosome assembly; ribosomal small subunit biogenesis and assembly; rRNA export from nucleus; regulation of endodeoxyribonuclease activity; negative regulation of nuclear mRNA splicing, via spliceosome; positive regulation of protein kinase activity; cell volume homeostasis; positive regulation of DNA replication; negative regulation of apoptosis