Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Neuropeptides B/W receptor type 2 (NPBWR2) Recombinant Protein | NPBWR2 recombinant protein

Recombinant Human Neuropeptides B/W receptor type 2 (NPBWR2)

Gene Names
NPBWR2; GPR8
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Neuropeptides B/W receptor type 2 (NPBWR2); Recombinant Human Neuropeptides B/W receptor type 2 (NPBWR2); Recombinant Neuropeptides B/W receptor type 2 (NPBWR2); Neuropeptides B/W receptor type 2; G-protein coupled receptor 8; NPBWR2 recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-333
Sequence
MQAAGHPEPLDSRGSFSLPTMGANVSQDNGTGHNATFSEPLPFLYVLLPAVYSGICAVGLTGNTAVILVILRAPKMKTVTNVFILNLAVADGLFTLVLPVNIAEHLLQYWPFGELLCKLVLAVDHYNIFSSIYFLAVMSVDRYLVVLATVRSRHMPWRTYRGAKVASLCVWLGVTVLVLPFFSFAGVYSNELQVPSCGLSFPWPEQVWFKASRVYTLVLGFVLPVCTICVLYTDLLRRLRAVRLRSGAKALGKARRKVTVLVLVVLAVCLLCWTPFHLASVVALTTDLPQTPLVISMSYVITSLSYANSCLNPFLYAFLDDNFRKNFRSILRC
Sequence Length
333
Species
Homo sapiens (Human)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
36,861 Da
NCBI Official Full Name
neuropeptides B/W receptor type 2
NCBI Official Synonym Full Names
neuropeptides B/W receptor 2
NCBI Official Symbol
NPBWR2
NCBI Official Synonym Symbols
GPR8
NCBI Protein Information
neuropeptides B/W receptor type 2; G protein-coupled receptor 8; G-protein coupled receptor 8; opioid-somatostatin-like receptor 8
UniProt Protein Name
Neuropeptides B/W receptor type 2
UniProt Gene Name
NPBWR2
UniProt Synonym Gene Names
GPR8
UniProt Entry Name
NPBW2_HUMAN

NCBI Description

The protein encoded by this gene is an integral membrane protein and G protein-coupled receptor. The encoded protein is similar in sequence to another G protein-coupled receptor (GPR7), and it is structurally similar to opioid and somatostatin receptors. This protein binds neuropeptides B and W. This gene is intronless and is expressed primarily in the frontal cortex of the brain. [provided by RefSeq, Jul 2008]

Uniprot Description

NPBWR2: Interacts specifically with a number of opioid ligands. Receptor for neuropeptides B and W, which may be involved in neuroendocrine system regulation, food intake and the organization of other signals. Belongs to the G-protein coupled receptor 1 family.

Protein type: Membrane protein, multi-pass; GPCR, family 1; Receptor, GPCR; Membrane protein, integral

Chromosomal Location of Human Ortholog: 20q13.3

Cellular Component: neuron projection; integral to plasma membrane; plasma membrane; integral to membrane

Molecular Function: neuropeptide binding; protein binding; neuropeptide receptor activity; opioid receptor activity

Biological Process: G-protein signaling, coupled to cyclic nucleotide second messenger; G-protein coupled receptor protein signaling pathway; synaptic transmission; neuropeptide signaling pathway

Research Articles on NPBWR2

Similar Products

Product Notes

The NPBWR2 npbwr2 (Catalog #AAA966524) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-333. The amino acid sequence is listed below: MQAAGHPEPL DSRGSFSLPT MGANVSQDNG TGHNATFSEP LPFLYVLLPA VYSGICAVGL TGNTAVILVI LRAPKMKTVT NVFILNLAVA DGLFTLVLPV NIAEHLLQYW PFGELLCKLV LAVDHYNIFS SIYFLAVMSV DRYLVVLATV RSRHMPWRTY RGAKVASLCV WLGVTVLVLP FFSFAGVYSN ELQVPSCGLS FPWPEQVWFK ASRVYTLVLG FVLPVCTICV LYTDLLRRLR AVRLRSGAKA LGKARRKVTV LVLVVLAVCL LCWTPFHLAS VVALTTDLPQ TPLVISMSYV ITSLSYANSC LNPFLYAFLD DNFRKNFRSI LRC. It is sometimes possible for the material contained within the vial of "Neuropeptides B/W receptor type 2 (NPBWR2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.