SDS-PAGE
Paracoccus denitrificans Nitrous-oxide reductase Recombinant Protein | nosZ recombinant protein
Recombinant Paracoccus denitrificans Nitrous-oxide reductase
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Paracoccus denitrificans Nitrous-oxide reductase; Recombinant Paracoccus denitrificans Nitrous-oxide reductase; N(2)OR; N2O reductase; nosZ recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
58-553aa; Full Length
Sequence
ASGDGSVAPGQLDDYYGFWSSGQSGEMRILGIPSMRELMRVPVFNRCSATGWGQTNESVRIHERTMSERTKKFLAANGKRIHDNGDLHHVHMSFTEGKYDGRFLFMNDKANTRVARVRCDVMKCDAILEIPNAKGIHGLRPQKWPRSNYVFCNGEDETPLVNDGTNMEDVANYVNVFTAVDADKWEVAWQVLVSGNLDNCDADYEGKWAFSTSYNSEKGMTLPEMTAAEMDHIVVFNIAEIEKAIAAGDYQELNGVKVVDGRKEASSLFTRYIPIANNPHGCNMAPDKKHLCVAGKLSPTATVLDVTRFDAVFYENADPRSAVVAEPELGLGPLHTAFDGRGNAYTSLFLDSQVVKWNIEDAIRAYAGEKVDPIKDKLDVHYQPGHLKTVMGETLDATNDWLVCLSKFSKDRFLNVGPLKPENDQLIDISGDKMVLVHDGPTFAEPHDAIAVHPSILSDIKSVWDRNDPMWAETRAQAEADGVDIDNWTEEVIRDG
Sequence Length
652
Species
Paracoccus denitrificans
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
SDS-PAGE
SDS-PAGE
Related Product Information for nosZ recombinant protein
Nitrous-oxide reductase is part of a bacterial respiratory system which is activated under anaerobic conditions in the presence of nitrate or nitrous oxide.
References
"Sequence and expression of the gene encoding the respiratory nitrous-oxide reductase from Paracoccus denitrificans. New and conserved structural and regulatory motifs."
Hoeren F.U., Berks B.C., Ferguson S.J., McCarthy J.E.G.
Eur. J. Biochem. 218:49-57(1993)
NCBI and Uniprot Product Information
NCBI GI #
UniProt Accession #
Molecular Weight
71.1 kDa
NCBI Official Full Name
Nitrous-oxide reductase
UniProt Protein Name
Nitrous-oxide reductase
Protein Family
UniProt Gene Name
nosZ
UniProt Entry Name
NOSZ_PARDE
Uniprot Description
Nitrous-oxide reductase is part of a bacterial respiratory system which is activated under anaerobic conditions in the presence of nitrate or nitrous oxide.
Similar Products
Product Notes
The nosZ nosz (Catalog #AAA1283029) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 58-553aa; Full Length. The amino acid sequence is listed below: ASGDGSVAPG QLDDYYGFWS SGQSGEMRIL GIPSMRELMR VPVFNRCSAT GWGQTNESVR IHERTMSERT KKFLAANGKR IHDNGDLHHV HMSFTEGKYD GRFLFMNDKA NTRVARVRCD VMKCDAILEI PNAKGIHGLR PQKWPRSNYV FCNGEDETPL VNDGTNMEDV ANYVNVFTAV DADKWEVAWQ VLVSGNLDNC DADYEGKWAF STSYNSEKGM TLPEMTAAEM DHIVVFNIAE IEKAIAAGDY QELNGVKVVD GRKEASSLFT RYIPIANNPH GCNMAPDKKH LCVAGKLSPT ATVLDVTRFD AVFYENADPR SAVVAEPELG LGPLHTAFDG RGNAYTSLFL DSQVVKWNIE DAIRAYAGEK VDPIKDKLDV HYQPGHLKTV MGETLDATND WLVCLSKFSK DRFLNVGPLK PENDQLIDIS GDKMVLVHDG PTFAEPHDAI AVHPSILSDI KSVWDRNDPM WAETRAQAEA DGVDIDNWTE EVIRDG. It is sometimes possible for the material contained within the vial of "Paracoccus denitrificans Nitrous-oxide reductase, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
