Protein nanos (nos) Recombinant Protein | nos recombinant protein
Recombinant Drosophila melanogaster Protein nanos (nos)
Gene Names
nos; CG5637; DmelCG5637; Dronanos; DRONANOS; l(3)07117; l(3)j3B6; l(3)j4B6; Nanos; NANOS; nNOS; Nos; NOS
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Protein nanos (nos); Recombinant Drosophila melanogaster Protein nanos (nos); nos recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-401, Full length protein
Sequence
MFRSNLEGSGAAAVGVANPPSLAQSGKIFQLQDNFSAFHARGGLNILGLQDMYLDTSGANSSATLSPPITPVTPDPSTSAQSTHFPFLADSAATANSLLMQRQYHYHLLLQQQQQLAMAQHQLALAASAAAASASHQQTDEIARSLKIFAQVTTGAAENAAGSMQDVMQEFATNGYASDDLGRMSYGSAPPQVQMPPQQQHQQQQGLHLPLGRNPAQLQTNGGNLMPIPLATHWLNNYREHLNNVWRNMSYIPAAPNTMGLQAQTAATVSTNLGVGMGLGLPVQGEQLRGASNSSNNNNNNNKVYKRYNSKAKEISRHCVFCENNNEPEAVINSHSVRDNFNRVLCPKLRTYVCPICGASGDSAHTIKYCPKKPIITMEDAIKAESFRLAKSSYYKQQMKV
Sequence Length
401
Species
Drosophila melanogaster (Fruit fly)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
43,428 Da
NCBI Official Full Name
nanos, isoform A
NCBI Official Synonym Full Names
nanos
NCBI Official Symbol
nos
NCBI Official Synonym Symbols
CG5637; DmelCG5637; Dronanos; DRONANOS; l(3)07117; l(3)j3B6; l(3)j4B6; Nanos; NANOS; nNOS; Nos; NOS
NCBI Protein Information
CG5637 gene product from transcript CG5637-RA
UniProt Protein Name
Protein nanos
Protein Family
UniProt Gene Name
nos
Uniprot Description
Maternal RNA-binding protein that is required for germ cells proliferation and self-renewal. Acts by forming a complex with pum and brat that regulates translation and mRNA stability. The complex binds to the Nanos Response Element (NRE), a 16 bp sequence in the hb mRNA 3'-UTR and prevents its translation. Controls posterior development. Rescuing factor for the abdominal defect of posterior group mutants. The other posterior group genes are not required for nanos function but rather play a role in localization or distribution of nanos protein.
Research Articles on nos
Similar Products
Product Notes
The nos nos (Catalog #AAA1205838) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-401, Full length protein. The amino acid sequence is listed below: MFRSNLEGSG AAAVGVANPP SLAQSGKIFQ LQDNFSAFHA RGGLNILGLQ DMYLDTSGAN SSATLSPPIT PVTPDPSTSA QSTHFPFLAD SAATANSLLM QRQYHYHLLL QQQQQLAMAQ HQLALAASAA AASASHQQTD EIARSLKIFA QVTTGAAENA AGSMQDVMQE FATNGYASDD LGRMSYGSAP PQVQMPPQQQ HQQQQGLHLP LGRNPAQLQT NGGNLMPIPL ATHWLNNYRE HLNNVWRNMS YIPAAPNTMG LQAQTAATVS TNLGVGMGLG LPVQGEQLRG ASNSSNNNNN NNKVYKRYNS KAKEISRHCV FCENNNEPEA VINSHSVRDN FNRVLCPKLR TYVCPICGAS GDSAHTIKYC PKKPIITMED AIKAESFRLA KSSYYKQQMK V. It is sometimes possible for the material contained within the vial of "Protein nanos (nos), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
