Nucleolar complex protein 4 homolog (Noc4l) Recombinant Protein | Noc4l recombinant protein
Recombinant Rat Nucleolar complex protein 4 homolog (Noc4l)
Gene Names
Noc4l; RGD1310661
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Nucleolar complex protein 4 homolog (Noc4l); Recombinant Rat Nucleolar complex protein 4 homolog (Noc4l); Noc4l recombinant protein
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-516aa; full length protein
Sequence
MERQPASTGSRQELGRLLEAVLSNRGRANAVFDILAVLQSEDPEEIKEGVRTCSRLFGTL LEREELFVGSLPCEDMALAGSQGATYKYKVWMRHRYHSCCNRLEELLTHPSFQVKELALE TLMKFVQLEGAKPLEKPQWESHYLFPRTLFRAVVGGLLTPEDDHSLLISQFCEYLEYDDI RYHAMQVATSILARATSRQPEVSLTFWNNAFTLLSAVNLPLQEHELTNFYVKHAQTSSKW KVVHLKEQRKAFQEMWLGFLKHKLPLSLYKKVLVAMHDSILPHLAQPTLMIDFLTSACDV GGAISLLALNGLFILIHKHNLEYPDFYQRLYGLLDPSIFHVKYRARFFHLADLFLSSSHL PAYLVAAFAKRLARLALTAPPEALLMVLPLICNLLRRHPACRVMVHRPQGPELDADPYDP TEKDPARSRALESCLWELQTLQQHYHPEVSRAASVINQALSVPEVSIAPLLELTAYEIFE QDLKKMMPESVPLEFIPAKGLLGRQDDLCTQFFCLS
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Rat
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for Noc4l recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
58,862 Da
NCBI Official Full Name
nucleolar complex protein 4 homolog
NCBI Official Synonym Full Names
nucleolar complex associated 4 homolog
NCBI Official Symbol
Noc4l
NCBI Official Synonym Symbols
RGD1310661
NCBI Protein Information
nucleolar complex protein 4 homolog
UniProt Protein Name
Nucleolar complex protein 4 homolog
Protein Family
UniProt Gene Name
Noc4l
UniProt Synonym Gene Names
NOC4 protein homolog
UniProt Entry Name
NOC4L_RAT
Uniprot Description
NOC4L: Belongs to the CBF/MAK21 family.
Protein type: Membrane protein, multi-pass; RNA processing; Membrane protein, integral; Nucleolus
Cellular Component: integral to membrane; nuclear membrane; nucleolus; nucleus; small subunit processome
Biological Process: maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
Similar Products
Product Notes
The Noc4l noc4l (Catalog #AAA7023389) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-516aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the Noc4l noc4l for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MERQPASTGS RQELGRLLEA VLSNRGRANA VFDILAVLQS EDPEEIKEGV RTCSRLFGTL LEREELFVGS LPCEDMALAG SQGATYKYKV WMRHRYHSCC NRLEELLTHP SFQVKELALE TLMKFVQLEG AKPLEKPQWE SHYLFPRTLF RAVVGGLLTP EDDHSLLISQ FCEYLEYDDI RYHAMQVATS ILARATSRQP EVSLTFWNNA FTLLSAVNLP LQEHELTNFY VKHAQTSSKW KVVHLKEQRK AFQEMWLGFL KHKLPLSLYK KVLVAMHDSI LPHLAQPTLM IDFLTSACDV GGAISLLALN GLFILIHKHN LEYPDFYQRL YGLLDPSIFH VKYRARFFHL ADLFLSSSHL PAYLVAAFAK RLARLALTAP PEALLMVLPL ICNLLRRHPA CRVMVHRPQG PELDADPYDP TEKDPARSRA LESCLWELQT LQQHYHPEVS RAASVINQAL SVPEVSIAPL LELTAYEIFE QDLKKMMPES VPLEFIPAKG LLGRQDDLCT QFFCLS. It is sometimes possible for the material contained within the vial of "Nucleolar complex protein 4 homolog (Noc4l), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
