Nisin biosynthesis sensor protein nisK (nisK) Recombinant Protein | nisK recombinant protein
Recombinant Lactococcus lactis subsp. lactis Nisin biosynthesis sensor protein nisK (nisK)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Nisin biosynthesis sensor protein nisK (nisK); Recombinant Lactococcus lactis subsp. lactis Nisin biosynthesis sensor protein nisK (nisK); Recombinant Nisin biosynthesis sensor protein nisK (nisK); Nisin biosynthesis sensor protein nisK EC= 2.7.13.3; nisK recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
168-447. Fragment at the C-terminal, include the Histidine kinase domain
Sequence
REFSKNFQAVQKIALKMGEITTFPEQEESKIIEFDQVLNNLYSKSKELAFLIEAERHEKHDLSFQVAALSHDVKTPLTVLKGNIELLEMTEVNEQQADFIESMKNSLTVFDKYFNTMISYTKLLNDENDYKATISLEDFLIDLSVELEELSTTYQVDYQLVKKTDLTTFYGNTLALSRALINIFVNACQYAKEGEKIVSLSIYDDEKYLYFEIWNNGHPFSEQAKKNAGKLFFTEDTGRSGKHYGIGLSFAQGVALKHQGNLILSNPQKGGAEVILKIKK
Sequence Length
447
Species
Lactococcus lactis subsp. lactis (Streptococcus lactis)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
NCBI and Uniprot Product Information
NCBI GI #
UniProt Accession #
Molecular Weight
51,320 Da
NCBI Official Full Name
Nisin biosynthesis sensor protein NisK
UniProt Protein Name
Nisin biosynthesis sensor protein NisK
Protein Family
UniProt Gene Name
nisK
UniProt Entry Name
NISK_LACLL
Uniprot Description
Function: Member of the two-component regulatory system NisK/NisR involved in the regulation of the biosynthesis of lantibiotic nisin. NisK may function as a membrane-associated protein kinase that phosphorylates NisR in response to environmental signals.
Catalytic activity: ATP + protein L-histidine = ADP + protein N-phospho-L-histidine.
Subcellular location: Cell membrane; Multi-pass membrane protein
Potential.
Sequence similarities: Contains 1 histidine kinase domain.
Similar Products
Product Notes
The Nisin biosynthesis sensor protein nisK (nisK) nisk (Catalog #AAA1242301) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 168-447. Fragment at the C-terminal, include the Histidine kinase domain. The amino acid sequence is listed below: REFSKNFQAV QKIALKMGEI TTFPEQEESK IIEFDQVLNN LYSKSKELAF LIEAERHEKH DLSFQVAALS HDVKTPLTVL KGNIELLEMT EVNEQQADFI ESMKNSLTVF DKYFNTMISY TKLLNDENDY KATISLEDFL IDLSVELEEL STTYQVDYQL VKKTDLTTFY GNTLALSRAL INIFVNACQY AKEGEKIVSL SIYDDEKYLY FEIWNNGHPF SEQAKKNAGK LFFTEDTGRS GKHYGIGLSF AQGVALKHQG NLILSNPQKG GAEVILKIKK . It is sometimes possible for the material contained within the vial of "Nisin biosynthesis sensor protein nisK (nisK), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
