Nickel transport protein NikQ (nikQ) Recombinant Protein | cbiQ1 recombinant protein
Recombinant Rhodobacter capsulatus Nickel transport protein NikQ (nikQ)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Nickel transport protein NikQ (nikQ); Recombinant Rhodobacter capsulatus Nickel transport protein NikQ (nikQ); Recombinant Nickel transport protein NikQ (nikQ); Nickel transport protein NikQ; Energy-coupling factor transporter transmembrane protein NikQ; ECF transporter T component NikQ; cbiQ1 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-284
Sequence
MTDPSVVHARAPAPDRIGRLGAGVRGLMQHAEEAAGLAQRPGLLQGLDPRAKVAGAFALILAAVATRSLLVLLALFVLATALAAASQISPARLARQVWIVVLGFTGMIALPALILVPGTPVLSLPFGLAITEQGLRAAAFLTGRSETTATLALALVLTTPWPQVLKALRCLGVPRAAVMILGMTHRYIFVLADLALDLFEARRSRLVGRLSPAEARRLATGIAGALFERALALSSEVHLAMLARGWRGEVHLIDDFRFRPRDGGALVLAAAILAGVVWAGSVWP
Sequence Length
284
Species
Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
29,859 Da
NCBI Official Full Name
cobalt ABC transporter permease CbiQ
NCBI Official Symbol
cbiQ1
NCBI Protein Information
cobalt ABC transporter permease CbiQ
UniProt Protein Name
Nickel transport protein NikQ
UniProt Gene Name
nikQ
UniProt Synonym Gene Names
cbiQ1; ECF transporter T component NikQ
UniProt Entry Name
NIKQ_RHOCB
Uniprot Description
Function: Part of the energy-coupling factor (ECF) transporter complex NikMNQO involved in nickel import. The complex confers nickel uptake upon expression in E.coli; can also transport cobalt with a very low affinity. Ref.2
Subunit structure: Forms an energy-coupling factor (ECF) transporter complex composed of an ATP-binding protein (A component, NikO), a transmembrane protein (T component, NikQ) and a fused possible substrate-capture protein (S component, NikMN) of unknown stoichimetry
By similarity. Ref.2
Subcellular location: Cell inner membrane; Multi-pass membrane protein
Potential.
Sequence similarities: Belongs to the CbiQ family.
Similar Products
Product Notes
The cbiQ1 nikq (Catalog #AAA1134534) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-284. The amino acid sequence is listed below: MTDPSVVHAR APAPDRIGRL GAGVRGLMQH AEEAAGLAQR PGLLQGLDPR AKVAGAFALI LAAVATRSLL VLLALFVLAT ALAAASQISP ARLARQVWIV VLGFTGMIAL PALILVPGTP VLSLPFGLAI TEQGLRAAAF LTGRSETTAT LALALVLTTP WPQVLKALRC LGVPRAAVMI LGMTHRYIFV LADLALDLFE ARRSRLVGRL SPAEARRLAT GIAGALFERA LALSSEVHLA MLARGWRGEV HLIDDFRFRP RDGGALVLAA AILAGVVWAG SVWP. It is sometimes possible for the material contained within the vial of "Nickel transport protein NikQ (nikQ), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
