H/ACA ribonucleoprotein complex subunit 2 (NHP2) Recombinant Protein | NHP2 recombinant protein

Recombinant Pongo abelii H/ACA ribonucleoprotein complex subunit 2 (NHP2)

Cat. Num. AAA1282711

• Gene Names: NHP2; NOLA2
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: H/ACA ribonucleoprotein complex subunit 2 (NHP2); Recombinant Pongo abelii H/ACA ribonucleoprotein complex subunit 2 (NHP2); NHP2 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-153, Full length protein
• Sequence: MTKIKADPDGPEAQAEACSGERTYQELLVNQNPIAQPLASRRLTRKLYKCIKKAVKQKQIRRGVKEVQKFVNKGEKGIMVLAGDTLPIEVYCHLPVMCEDRNLPYVYIPSKTDLGAAAGSKRPTCVIMVKPHDEYQEAYDECLEEVQSLPLPL
• Sequence Length: 153

• Species: Pongo abelii (Sumatran orangutan)
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

• NCBI GI #: 197100394
• NCBI GeneID: 100172250
• NCBI Accession #: NP_001125348.1
• NCBI GenBank Nucleotide #: NM_001131876.2
• UniProt Accession #: Q5RC65
• Molecular Weight: 17,187 Da
• NCBI Official Full Name: H/ACA ribonucleoprotein complex subunit 2
• NCBI Official Symbol: NHP2
• NCBI Official Synonym Symbols: NOLA2
• NCBI Protein Information: H/ACA ribonucleoprotein complex subunit 2
• UniProt Protein Name: H/ACA ribonucleoprotein complex subunit 2
• Protein Family: H/ACA ribonucleoprotein complex
• UniProt Gene Name: NHP2
• UniProt Synonym Gene Names: NOLA2

Uniprot Description

Required for ribosome biogenesis and telomere maintenance. Part of the H/ACA small nucleolar ribonucleoprotein (H/ACA snoRNP) complex, which catalyzes pseudouridylation of rRNA. This involves the isomerization of uridine such that the ribose is subsequently attached to C5, instead of the normal N1. Each rRNA can contain up to 100 pseudouridine ("psi") residues, which may serve to stabilize the conformation of rRNAs. May also be required for correct processing or intranuclear trafficking of TERC, the RNA component of the telomerase reverse transcriptase (TERT) holoenzyme ().