Mouse anti-Human EIF4ENIF1 Monoclonal Antibody | anti-EIF4ENIF1 antibody

EIF4ENIF1 (Eukaryotic Translation Initiation Factor 4E Transporter, 4E-T, eIF4E Transporter, Eukaryotic Translation Initiation Factor 4E Nuclear Import Factor 1, 2610509L04Rik, FLJ21601, FLJ26551) (Biotin)

Cat. Num. AAA6141698

• Gene Names: EIF4ENIF1; 4E-T; Clast4
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: EIF4ENIF1; Monoclonal Antibody; EIF4ENIF1 (Eukaryotic Translation Initiation Factor 4E Transporter; 4E-T; eIF4E Transporter; Eukaryotic Translation Initiation Factor 4E Nuclear Import Factor 1; 2610509L04Rik; FLJ21601; FLJ26551) (Biotin); anti-EIF4ENIF1 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 2C4
• Specificity: Recognizes human EIF4ENIF1.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.

• Applicable Applications for anti-EIF4ENIF1 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa886-986 from human EIF4ENIF1 (NP_062817) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: NPRPGTPLHLAMVQQQLQRSVLHPPGSGSHAAAVSVQTTPQNVPSRSGLPHMHSQLEHRPSQRSSSPVGLAKWFGSDVLQQPLPSMPAKVISVDELEYRQ
• Conjugate: Biotin
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.11kD).)

Related Product Information for anti-EIF4ENIF1 antibody

Nucleoplasmic shuttling protein. Mediates the nuclear import of EIF4E by a piggy-back mechanism.

Product Categories/Family for anti-EIF4ENIF1 antibody

Antibodies; Translation Initiation Factors

NCBI and Uniprot Product Information

• NCBI GI #: 256818794
• NCBI GeneID: 56478
• NCBI Accession #: NP_062817
• NCBI GenBank Nucleotide #: NM_019843
• UniProt Accession #: Q9NRA8
• Molecular Weight: 108kDa
• NCBI Official Full Name: eukaryotic translation initiation factor 4E transporter isoform a
• NCBI Official Synonym Full Names: eukaryotic translation initiation factor 4E nuclear import factor 1
• NCBI Official Symbol: EIF4ENIF1
• NCBI Official Synonym Symbols: 4E-T; Clast4
• NCBI Protein Information: eukaryotic translation initiation factor 4E transporter
• UniProt Protein Name: Eukaryotic translation initiation factor 4E transporter
• Protein Family: Eukaryotic translation initiation factor 4E transporter
• UniProt Gene Name: EIF4ENIF1
• UniProt Synonym Gene Names: 4E-T
• UniProt Entry Name: 4ET_HUMAN

NCBI Description

The protein encoded by this gene is a nucleocytoplasmic shuttle protein for the translation initiation factor eIF4E. This shuttle protein interacts with the importin alpha-beta complex to mediate nuclear import of eIF4E. It is predominantly cytoplasmic; its own nuclear import is regulated by a nuclear localization signal and nuclear export signals. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Aug 2009]

Uniprot Description

Function: Nucleoplasmic shuttling protein. Mediates the nuclear import of EIF4E by a piggy-back mechanism.

Subunit structure: Interacts with EIF4E. Interacts with importin beta only in the presence of importin alpha, suggesting a direct interaction with importin alpha. Interacts with APOBEC3G in an RNA-dependent manner. Ref.7

Subcellular location: Cytoplasm. Nucleus. Nucleus › PML body. Nucleus speckle. Note: Predominantly cytoplasmic. Shuttles between the nucleus and the cytoplasm in a CRM1-dependent manner. Localization to nuclear foci and speckles requires active transcription. Ref.16

Tissue specificity: Widely expressed.

Sequence caution: The sequence BAB15092.1 differs from that shown. Reason: Erroneous initiation. The sequence BAC11194.1 differs from that shown. Reason: Erroneous initiation.