SDS-PAGE
Beta-nerve growth factor Recombinant Protein | Ngf recombinant protein
Recombinant Rat Beta-nerve growth factor
Gene Names
Ngf; Ngfb; beta-NGF
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Beta-nerve growth factor; Recombinant Rat Beta-nerve growth factor; Ngf recombinant protein
Host
E Coli
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
124-241aa; Partial
Sequence
THPVFHMGEFSVCDSVSVWVGDKTTATDIKGKEVTVLGEVNINNSVFKQYFFETKCRAPNPVESGCRGIDSKHWNSYCTTTHTFVKALTTDDKQAAWRFIRIDTACVCVLSRKAARRG
Sequence Length
241
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
SDS-PAGE
SDS-PAGE
Related Product Information for Ngf recombinant protein
Nerve growth factor is important for the development and maintenance of the sympathetic and sensory nervous systems. Extracellular ligand for the NTRK1 and NGFR receptors, activates cellular signaling cascades through those receptor tyrosine kinase to regulate neuronal proliferation, differentiation and survival. Inhibits metalloproteinase dependent proteolysis of platelet glycoprotein VI.
References
Rat beta-nerve growth factor sequence and site of synthesis in the adult hippocampus.Whittemore S.R., Friedman P.L., Larhammar D.G., Persson H., Gonzalez-Carvajal M., Holets V.R.J. Neurosci. Res. 20:403-410(1988)
Evolutionary studies of the nerve growth factor family reveal a novel member abundantly expressed in Xenopus ovary.Hallboeoek F., Ibanez C.F., Persson H.Neuron 6:845-858(1991)
A novel NGF mutation clarifies the molecular mechanism and extends the phenotypic spectrum of the HSAN5 neuropathy.Carvalho O.P., Thornton G.K., Hertecant J., Houlden H., Nicholas A.K., Cox J.J., Rielly M., Al-Gazali L., Woods C.G.J. Med. Genet. 48:131-135(2011)
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
17.2 kDa
NCBI Official Full Name
beta-nerve growth factor
NCBI Official Synonym Full Names
nerve growth factor (beta polypeptide)
NCBI Official Symbol
Ngf
NCBI Official Synonym Symbols
Ngfb; beta-NGF
NCBI Protein Information
beta-nerve growth factor
UniProt Protein Name
Beta-nerve growth factor
Protein Family
UniProt Gene Name
Ngf
UniProt Synonym Gene Names
Ngfb; Beta-NGF
UniProt Entry Name
NGF_RAT
Uniprot Description
Nerve growth factor is important for the development and maintenance of the sympathetic and sensory nervous systems. Extracellular ligand for the NTRK1 and NGFR receptors, activates cellular signaling cascades through those receptor tyrosine kinase to regulate neuronal proliferation, differentiation and survival. Inhibits metalloproteinase dependent proteolysis of platelet glycoprotein VI.
Research Articles on Ngf
Similar Products
Product Notes
The Ngf ngf (Catalog #AAA1265559) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 124-241aa; Partial. The amino acid sequence is listed below: THPVFHMGEF SVCDSVSVWV GDKTTATDIK GKEVTVLGEV NINNSVFKQY FFETKCRAPN PVESGCRGID SKHWNSYCTT THTFVKALTT DDKQAAWRFI RIDTACVCVL SRKAARRG. It is sometimes possible for the material contained within the vial of "Beta-nerve growth factor, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
