Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.11kD).)

Mouse anti-Human MEX3B Monoclonal Antibody

MEX3B (RNA-binding Protein MEX3B, MEX-3B, KIAA2009, RING Finger and KH Domain-containing Protein 3, RKHD3, RING Finger Protein 195, RNF195)

Reactivity
Human
Applications
ELISA, Western Blot
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
MEX3B; Monoclonal Antibody; MEX3B (RNA-binding Protein MEX3B; MEX-3B; KIAA2009; RING Finger and KH Domain-containing Protein 3; RKHD3; RING Finger Protein 195; RNF195); Anti -MEX3B (RNA-binding Protein MEX3B; anti-MEX3B antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
4C4
Specificity
Recognizes human RKHD3.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
RKKSVNMTECVPVPSSEHVAEIVGRQGCKIKALRAKTNTYIKTPVRGEEPVFVVTGRKEDVAMARREIISAAEHFSMIRASRNKNTALNGAVPGPPNLPG
Applicable Applications for anti-MEX3B antibody
ELISA (EL/EIA), Western Blot (WB)
Application Notes
Suitable for use in ELISA and Western Blot.
Immunogen
Partial recombinant corresponding to aa60-160 from human RKHD3 (NP_115622) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.11kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.11kD).)
Product Categories/Family for anti-MEX3B antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI Official Full Name
MEX3B
Protein Family

Uniprot Description

RKHD3: RNA-binding protein. May be involved in post- transcriptional regulatory mechanisms. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Ubiquitin conjugating system; RNA-binding

Chromosomal Location of Human Ortholog: 15q25.2

Cellular Component: nucleoplasm; cytoplasm

Molecular Function: zinc ion binding; calcium ion binding

Biological Process: protein amino acid autophosphorylation; protein amino acid phosphorylation

Similar Products

Product Notes

The MEX3B (Catalog #AAA6003029) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The MEX3B (RNA-binding Protein MEX3B, MEX-3B, KIAA2009, RING Finger and KH Domain-containing Protein 3, RKHD3, RING Finger Protein 195, RNF195) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's MEX3B can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA), Western Blot (WB). Suitable for use in ELISA and Western Blot. Researchers should empirically determine the suitability of the MEX3B for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: RKKSVNMTEC VPVPSSEHVA EIVGRQGCKI KALRAKTNTY IKTPVRGEEP VFVVTGRKED VAMARREIIS AAEHFSMIRA SRNKNTALNG AVPGPPNLPG. It is sometimes possible for the material contained within the vial of "MEX3B, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.