Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Nuclear factor of activated T-cells, cytoplasmic 1 (NFATC1) Recombinant Protein | NFATC1 recombinant protein

Recombinant Human Nuclear factor of activated T-cells, cytoplasmic 1 (NFATC1) , partial

Gene Names
NFATC1; NFAT2; NFATc; NF-ATC; NF-ATc1.2
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Nuclear factor of activated T-cells; cytoplasmic 1 (NFATC1); Recombinant Human Nuclear factor of activated T-cells; partial; NFATC1 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
414-591 . Partial
Sequence
ALDWQLPSHSGPYELRIEVQPKSHHRAHYETEGSRGAVKASAGGHPIVQLHGYLENEPLMLQLFIGTADDRLLRPHAFYQVHRITGKTVSTTSHEAILSNTKVLEIPLLPENSMRAVIDCAGILKLRNSDIELRKGETDIGRKNTRVRLVFRVHVPQPSGRTLSLQVASNPIECSQRS
Species
Human
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for NFATC1 recombinant protein
The product of this gene is a component of the nuclear factor of activated T cells DNA-binding transcription complex. This complex consists of at least two components: a preexisting cytosolic component that translocates to the nucleus upon T cell receptor (TCR) stimulation, and an inducible nuclear component. Proteins belonging to this family of transcription factors play a central role in inducible gene transcription during immune response. The product of this gene is an inducible nuclear component. It functions as a major molecular target for the immunosuppressive drugs such as cyclosporin A. Five transcript variants encoding distinct isoforms have been identified for this gene. Different isoforms of this protein may regulate inducible expression of different cytokine genes.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
38,626 Da
NCBI Official Full Name
nuclear factor of activated T-cells, cytoplasmic 1 isoform F
NCBI Official Synonym Full Names
nuclear factor of activated T cells 1
NCBI Official Symbol
NFATC1
NCBI Official Synonym Symbols
NFAT2; NFATc; NF-ATC; NF-ATc1.2
NCBI Protein Information
nuclear factor of activated T-cells, cytoplasmic 1
UniProt Protein Name
Nuclear factor of activated T-cells, cytoplasmic 1
UniProt Gene Name
NFATC1
UniProt Synonym Gene Names
NFAT2; NFATC; NF-ATc1; NFATc1; NF-ATc; NFATc

NCBI Description

The product of this gene is a component of the nuclear factor of activated T cells DNA-binding transcription complex. This complex consists of at least two components: a preexisting cytosolic component that translocates to the nucleus upon T cell receptor (TCR) stimulation, and an inducible nuclear component. Proteins belonging to this family of transcription factors play a central role in inducible gene transcription during immune response. The product of this gene is an inducible nuclear component. It functions as a major molecular target for the immunosuppressive drugs such as cyclosporin A. Multiple alternatively spliced transcript variants encoding distinct isoforms have been identified for this gene. Different isoforms of this protein may regulate inducible expression of different cytokine genes. [provided by RefSeq, Jul 2013]

Uniprot Description

Plays a role in the inducible expression of cytokine genes in T-cells, especially in the induction of the IL-2 or IL-4 gene transcription. Also controls gene expression in embryonic cardiac cells. Could regulate not only the activation and proliferation but also the differentiation and programmed death of T-lymphocytes as well as lymphoid and non-lymphoid cells (PubMed:10358178). Required for osteoclastogenesis and regulates many genes important for osteoclast differentiation and function ().

Research Articles on NFATC1

Similar Products

Product Notes

The NFATC1 nfatc1 (Catalog #AAA1074618) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 414-591. Partial. The amino acid sequence is listed below: ALDWQLPSHS GPYELRIEVQ PKSHHRAHYE TEGSRGAVKA SAGGHPIVQL HGYLENEPLM LQLFIGTADD RLLRPHAFYQ VHRITGKTVS TTSHEAILSN TKVLEIPLLP ENSMRAVIDC AGILKLRNSD IELRKGETDI GRKNTRVRLV FRVHVPQPSG RTLSLQVASN PIECSQRS . It is sometimes possible for the material contained within the vial of "Nuclear factor of activated T-cells, cytoplasmic 1 (NFATC1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.