Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

N-terminal EF-hand calcium-binding protein 3 (NECAB3) Recombinant Protein | NECAB3 recombinant protein

Recombinant Human N-terminal EF-hand calcium-binding protein 3 (NECAB3)

Gene Names
NECAB3; NIP1; XB51; STIP3; EFCBP3; SYTIP2; APBA2BP; dJ63M2.4; dJ63M2.5
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
N-terminal EF-hand calcium-binding protein 3 (NECAB3); Recombinant Human N-terminal EF-hand calcium-binding protein 3 (NECAB3); NECAB3 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-396, Full length protein
Sequence
MACAGLLTVCLLRPPAPQPQPQTPRHPQLAPDPGPAGHTLFQDVFRRADKNDDGKLSFEEFQNYFADGVLSLGELQELFSGIDGHLTDNLETEKLCDYFSEHLGVYRPVLAALESLNRAVLAAMDATKLEYERASKVDQFVTRFLLRETVSQLQALQSSLEGASDTLEAQAHGWRSDAESVEAQSRLCGSRRAGRRALRSVSRSSTWSPGSSDTGRSSEAEMQWRLQVNRLQELIDQLECKVRAVGPGPHKGGPSWYPPEPGPCWRPGPHSVPSQAPRLEPLREEDLAKGPDLHILMAQRQVQVAEEGLQDFHRALRCYVDFTGAQSHCLHVSAQKMLDGASFTLYEFWQDEASWRRHQQSPGSKAFQRILIDHLRAPDTLTTVFFPASWWIMNNN
Sequence Length
396
Species
Human
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for NECAB3 recombinant protein
This protein interacts with the amino-terminal domain of the neuron-specific X11-like protein (X11L), inhibits the association of X11L with amyloid precursor protein through a non-competitive mechanism, and abolishes the suppression of beta-amyloid production by X11L. This protein, together with X11L, may play an important role in the regulatory system of amyloid precursor protein metabolism and beta-amyloid generation. The protein is phosphorylated by NIMA-related expressed kinase 2, and localizes to the Golgi apparatus. Multiple transcript variants encoding different isoforms have been found for this gene.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
22,251 Da
NCBI Official Full Name
N-terminal EF-hand calcium-binding protein 3 isoform 1
NCBI Official Synonym Full Names
N-terminal EF-hand calcium binding protein 3
NCBI Official Symbol
NECAB3
NCBI Official Synonym Symbols
NIP1; XB51; STIP3; EFCBP3; SYTIP2; APBA2BP; dJ63M2.4; dJ63M2.5
NCBI Protein Information
N-terminal EF-hand calcium-binding protein 3
UniProt Protein Name
N-terminal EF-hand calcium-binding protein 3
UniProt Gene Name
NECAB3
UniProt Synonym Gene Names
APBA2BP; NIP1; SYTIP2; XB51

NCBI Description

The protein encoded by this gene interacts with the amino-terminal domain of the neuron-specific X11-like protein (X11L), inhibits the association of X11L with amyloid precursor protein through a non-competitive mechanism, and abolishes the suppression of beta-amyloid production by X11L. This protein, together with X11L, may play an important role in the regulatory system of amyloid precursor protein metabolism and beta-amyloid generation. The protein is phosphorylated by NIMA-related expressed kinase 2, and localizes to the Golgi apparatus. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

Inhibits the interaction of APBA2 with amyloid-beta precursor protein (APP), and hence allows formation of amyloid-beta. May enhance the activity of HIF1A and thus promote glycolysis under normoxic conditions; the function requires its ABM domain and may implicate the stabilization of the interaction between HIF1AN and APBA3.

Research Articles on NECAB3

Similar Products

Product Notes

The NECAB3 necab3 (Catalog #AAA1439164) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-396, Full length protein. The amino acid sequence is listed below: MACAGLLTVC LLRPPAPQPQ PQTPRHPQLA PDPGPAGHTL FQDVFRRADK NDDGKLSFEE FQNYFADGVL SLGELQELFS GIDGHLTDNL ETEKLCDYFS EHLGVYRPVL AALESLNRAV LAAMDATKLE YERASKVDQF VTRFLLRETV SQLQALQSSL EGASDTLEAQ AHGWRSDAES VEAQSRLCGS RRAGRRALRS VSRSSTWSPG SSDTGRSSEA EMQWRLQVNR LQELIDQLEC KVRAVGPGPH KGGPSWYPPE PGPCWRPGPH SVPSQAPRLE PLREEDLAKG PDLHILMAQR QVQVAEEGLQ DFHRALRCYV DFTGAQSHCL HVSAQKMLDG ASFTLYEFWQ DEASWRRHQQ SPGSKAFQRI LIDHLRAPDT LTTVFFPASW WIMNNN. It is sometimes possible for the material contained within the vial of "N-terminal EF-hand calcium-binding protein 3 (NECAB3), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.