CD337 recombinant protein

CD337 Recombinant Protein

Cat. Num. AAA3004241

• Gene Names: NCR3; 1C7; MALS; CD337; LY117; NKp30
• Purity: Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is >85% (by SDS-PAGE).
• Synonyms: CD337; CD337 Recombinant Protein; CD337 recombinant protein

• Host: E Coli
• Purity/Purification: Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is >85% (by SDS-PAGE).
• Form/Format: PBS, 4M Urea, PH7.4
• Concentration: >=0.5mg/ml (varies by lot)
• Sequence: LWVSQPPEIRTLEGSSAFLPCSFNASQGRLAIGSVTWFRDEVVPGKEVRNGTPEFRGRLAPLASSRFLHDHQAELHIRDVRGHDASIYVCRVEVLGLGVGTGNGTRLVVEKEHPQLG

• Tag: His-tag in C-terminal
• Expression Vector: pet-22b(+)
• BP: 363
• Restriction Site: NdeI-XhoI
• Preparation and Storage: Store at 4 degee C for short term. Aliquot and store at -20 degee C long term. Avoid freeze-thaw cycles.

Testing Data

()

Related Product Information for CD337 recombinant protein

Background: The immune response is the way the body recognizes and defends itself against microorganisms, viruses and substances recognized as foreign and potentially harmful to the body. Innate immunity is the barrier that keeps foreign materials from entering the body and represents the first line of defense in the immune response. During the innate response to many inflammatory and infectious stimuli, dendritic cells (DCs) undergo a differentiation process termed maturation. Mature DCs activate antigen-specific naive Tcells and resting human natural killer (NK) cells. NK cell receptors NKp30, NKp44 and NKp46 appear to play prominent roles in NK cell activation. The human NKp30 gene maps to chromosome 6p21.3 and encodes a 190 amino acid protein. The NKp30 protein contains a signal peptide followed by a 120 amino acid extracellular region that forms a V-type Ig-like domain with 2 potential N-linked glycosylation sites, a hydrophobic transmembrane region with a positively charged Arginine residue, and a 33 amino acid cytoplasmictail lacking an immunoreceptor tyrosine-based activating motif (ITAM). NKp30 cooperates with NKp46 and/or NKp44 in the induction of NK-mediated cytotoxicity against the majority of target cells, where it represents the major triggering receptor in the killing of certain tumors.

NCBI and Uniprot Product Information

• NCBI GI #: 224586860
• NCBI GeneID: 259197
• NCBI Accession #: NP_001138938.1
• NCBI GenBank Nucleotide #: NM_001145466.1
• UniProt Accession #: O14931; O14930; O14932; O95667; O95668; O95669; Q5ST89; Q5ST90; Q5ST91; B0S8F2; B0S8F4; B0S8F5
• Molecular Weight: 21,593 Da
• NCBI Official Full Name: natural cytotoxicity triggering receptor 3 isoform b
• NCBI Official Synonym Full Names: natural cytotoxicity triggering receptor 3
• NCBI Official Symbol: NCR3
• NCBI Official Synonym Symbols: 1C7; MALS; CD337; LY117; NKp30
• NCBI Protein Information: natural cytotoxicity triggering receptor 3; NK-p30; lymphocyte antigen 117; activating NK-A1 receptor; activating natural killer receptor p30; natural killer cell p30-related protein
• UniProt Protein Name: Natural cytotoxicity triggering receptor 3
• UniProt Gene Name: NCR3
• UniProt Synonym Gene Names: 1C7; LY117; NK-p30; NKp30
• UniProt Entry Name: NCTR3_HUMAN

NCBI Description

The protein encoded by this gene is a natural cytotoxicity receptor (NCR) that may aid NK cells in the lysis of tumor cells. The encoded protein interacts with CD3-zeta (CD247), a T-cell receptor. A single nucleotide polymorphism in the 5' untranslated region of this gene has been associated with mild malaria suceptibility. Three transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq, May 2010]

Uniprot Description

NCR3: Cytotoxicity-activating receptor that contributes to the increased efficiency of activated natural killer (NK) cells to mediate tumor cell lysis. Engagement of NCR3 by BAG6 also promotes dendritic cell (DC) maturation, both through killing those DCs that did not properly acquire a mature phenotype, and inducing NK cells to release TNFA and IFNG, which promotes DC maturation. Belongs to the natural cytotoxicity receptor (NCR) family. 6 isoforms of the human protein are produced by alternative splicing.

Protein type: Apoptosis; Receptor, misc.; Membrane protein, integral

Chromosomal Location of Human Ortholog: 6p21.3

Cellular Component: integral to plasma membrane

Biological Process: immune response; cell recognition; inflammatory response; positive regulation of natural killer cell mediated cytotoxicity

Disease: Malaria, Mild, Susceptibility To