Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Neutrophil cytosol factor 4 (Ncf4) Recombinant Protein | Ncf4 recombinant protein

Recombinant Mouse Neutrophil cytosol factor 4 (Ncf4)

Gene Names
Ncf4; p40phox; AI451400
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Neutrophil cytosol factor 4 (Ncf4); Recombinant Mouse Neutrophil cytosol factor 4 (Ncf4); Ncf4 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-339, Full length protein
Sequence
MALAQQLRSESDFEQLPDDVAVSANIADIEEKRGFTSHFVFVIEVKTKGGSKYLIYRRYRQFYALQSKLEERFGPESKNSPFTCSLPTLPAKVYMGAKQEIAETRIPALNAYMKNLLSLPVCVLMDPDVRIFFYQSAYDAEQVPQALRRLRPRTRKIKGVSPQGAIMDRMEAPRAEALFDFTGNSKLELSFKAGDVIFLLSKINKDWLEGTSQGATGIFPGSFVKILKDFPEDEDTTNWLRCYFYEDTGKTIKDIAVEEDLSSTPLFKDLLALMRREFQREDIALSYQDAEGDLVRLLSDEDVGLMVKQARGLPSQKRLFPWKLHVTQKDNYSVYNTVP
Sequence Length
339
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Ncf4 recombinant protein
This protein is a cytosolic regulatory component of the superoxide-producing phagocyte NADPH-oxidase, a multicomponent enzyme system important for host defense. This protein is preferentially expressed in cells of myeloid lineage. It interacts primarily with neutrophil cytosolic factor 2 (NCF2
p67-phox) to form a complex with neutrophil cytosolic factor 1 (NCF1
p47-phox), which further interacts with the small G protein RAC1 and translocates to the membrane upon cell stimulation. This complex then activates flavocytochrome b, the membrane-integrated catalytic core of the enzyme system. The PX domain of this protein can bind phospholipid products of the PI(3) kinase, which suggests its role in PI(3) kinase-mediated signaling events. The phosphorylation of this protein was found to negatively regulate the enzyme activity. Alternatively spliced transcript variants encoding distinct isoforms have been observed.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
38,707 Da
NCBI Official Full Name
neutrophil cytosol factor 4
NCBI Official Synonym Full Names
neutrophil cytosolic factor 4
NCBI Official Symbol
Ncf4
NCBI Official Synonym Symbols
p40phox; AI451400
NCBI Protein Information
neutrophil cytosol factor 4
UniProt Protein Name
Neutrophil cytosol factor 4
Protein Family
UniProt Gene Name
Ncf4
UniProt Synonym Gene Names
NCF-4; p40phox

Uniprot Description

Component of the NADPH-oxidase, a multicomponent enzyme system responsible for the oxidative burst in which electrons are transported from NADPH to molecular oxygen, generating reactive oxidant intermediates. It may be important for the assembly and/or activation of the NADPH-oxidase complex.

Research Articles on Ncf4

Similar Products

Product Notes

The Ncf4 ncf4 (Catalog #AAA717984) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-339, Full length protein. The amino acid sequence is listed below: MALAQQLRSE SDFEQLPDDV AVSANIADIE EKRGFTSHFV FVIEVKTKGG SKYLIYRRYR QFYALQSKLE ERFGPESKNS PFTCSLPTLP AKVYMGAKQE IAETRIPALN AYMKNLLSLP VCVLMDPDVR IFFYQSAYDA EQVPQALRRL RPRTRKIKGV SPQGAIMDRM EAPRAEALFD FTGNSKLELS FKAGDVIFLL SKINKDWLEG TSQGATGIFP GSFVKILKDF PEDEDTTNWL RCYFYEDTGK TIKDIAVEED LSSTPLFKDL LALMRREFQR EDIALSYQDA EGDLVRLLSD EDVGLMVKQA RGLPSQKRLF PWKLHVTQKD NYSVYNTVP. It is sometimes possible for the material contained within the vial of "Neutrophil cytosol factor 4 (Ncf4), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.