Mouse anti-Human BPNT1 Monoclonal Antibody | anti-BPNT1 antibody

BPNT1 (3'(2'),5'-bisphosphate nucleotidase 1, Bisphosphate 3'-nucleotidase 1, PAP-inositol 1,4-phosphatase) (Biotin)

Cat. Num. AAA6140848

• Gene Names: BPNT1; PIP; HEL20
• Reactivity: Human
• Applications: ELISA, Immunofluorescence, Immunohistochemistry, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: BPNT1; Monoclonal Antibody; BPNT1 (3'(2'); 5'-bisphosphate nucleotidase 1; Bisphosphate 3'-nucleotidase 1; PAP-inositol 1; 4-phosphatase) (Biotin); anti-BPNT1 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 2E1
• Specificity: Recognizes human BPNT1.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.

• Applicable Applications for anti-BPNT1 antibody: ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB)
• Application Notes: IF: 10ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa1-100 from BPNT1 (NP_006076) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MASSNTVLMRLVASAYSIAQKAGMIVRRVIAEGDLGIVEKTCATDLQTKADRLAQMSICSSLARKFPKLTIIGEEDLPSEEVDQELIEDSQWEEILKQPC
• Conjugate: Biotin
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.74kD).)

Western Blot (WB)

(Western Blot analysis of BPNT1 expression in transfected 293T cell line by BPNT1 monoclonal antibody. Lane 1: BPNT1 transfected lysate (28.1kD). Lane 2: Non-transfected lysate.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to BPNT1 on formalin-fixed paraffin-embedded human pancreas. [antibody concentration 3ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to BPNT1 on HeLa cell. [antibody concentration 10ug/ml])

Testing Data

(Detection limit for recombinant GST tagged BPNT1 is ~0.03ng/ml as a capture antibody.)

Western Blot (WB)

(BPNT1 monoclonal antibody Western Blot analysis of BPNT1 expression in HeLa.)

Product Categories/Family for anti-BPNT1 antibody

Antibodies; Enzymes; Nucleotidase

NCBI and Uniprot Product Information

• NCBI GI #: 116812595
• NCBI GeneID: 10380
• NCBI Accession #: NP_006076
• NCBI GenBank Nucleotide #: NM_006085
• UniProt Accession #: O95861; Q8WVL5; Q9UGJ3; A8K7C8; B4DPS5; B4DUS9; D3DTA9
• Molecular Weight: 37.5 kDa (344aa), confirmed by MALDI-TOF (Molecular weight on SDS-PAGE will appear higher)
• NCBI Official Full Name: 3'(2'),5'-bisphosphate nucleotidase 1 isoform 1
• NCBI Official Synonym Full Names: 3'(2'), 5'-bisphosphate nucleotidase 1
• NCBI Official Symbol: BPNT1
• NCBI Official Synonym Symbols: PIP; HEL20
• NCBI Protein Information: 3'(2'),5'-bisphosphate nucleotidase 1
• UniProt Protein Name: 3'(2'),5'-bisphosphate nucleotidase 1
• UniProt Gene Name: BPNT1
• UniProt Synonym Gene Names: PIP
• UniProt Entry Name: BPNT1_HUMAN

NCBI Description

BPNT1, also called bisphosphate 3-prime-nucleotidase, or BPntase, is a member of a magnesium-dependent phosphomonoesterase family. Lithium, a major drug used to treat manic depression, acts as an uncompetitive inhibitor of BPntase. The predicted human protein is 92% identical to mouse BPntase. BPntase's physiologic role in nucleotide metabolism may be regulated by inositol signaling pathways. The inhibition of human BPntase may account for lithium-induced nephrotoxicity. [provided by RefSeq, Jul 2008]

Uniprot Description

BPNT1: Converts adenosine 3'-phosphate 5'-phosphosulfate (PAPS) to adenosine 5'-phosphosulfate (APS) and 3'(2')-phosphoadenosine 5'- phosphate (PAP) to AMP. Has 1000-fold lower activity towards inositol 1,4-bisphosphate (Ins(1,4)P2) and inositol 1,3,4- trisphosphate (Ins(1,3,4)P3), but does not hydrolyze Ins(1)P, Ins(3,4)P2, Ins(1,3,4,5)P4 or InsP6. Belongs to the inositol monophosphatase family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Motility/polarity/chemotaxis; Phosphatase (non-protein); Energy Metabolism - sulfur; EC 3.1.3.7

Chromosomal Location of Human Ortholog: 1q41

Cellular Component: cytosol

Molecular Function: inositol-1,4-bisphosphate 1-phosphatase activity; magnesium ion binding; 3'(2'),5'-bisphosphate nucleotidase activity

Biological Process: nervous system development; dephosphorylation; phosphoinositide phosphorylation; xenobiotic metabolic process; nucleobase, nucleoside, nucleotide and nucleic acid metabolic process; 3'-phosphoadenosine 5'-phosphosulfate metabolic process