Neurocalcin-delta (NCALD) Recombinant Protein | NCALD recombinant protein
Recombinant Chicken Neurocalcin-delta (NCALD)
Gene Names
NCALD; neurocalcin-delta
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Neurocalcin-delta (NCALD); Recombinant Chicken Neurocalcin-delta (NCALD); NCALD recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
2-193, Full length protein
Sequence
GKQNSKLRPEVMQDLLESTDFTEHEIQEWYKGFLRDCPSGHLSMEEFKKIYGNFFPYGDASKFAEHVFRTFDANGDGTIDFREFIIALSVTSRGKLEQKLKWAFSMYDLDGNGYISKSEMLEIVQAIYKMVSSVMKMPEDESTPEKRTEKIFRQMDTNRDGKLSLEEFIRGAKSDPSIVRLLQCDPSSAGQF
Sequence Length
192
Species
Chicken
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for NCALD recombinant protein
This gene encodes a member of the neuronal calcium sensor (NCS) family of calcium-binding proteins. The protein contains an N-terminal myristoylation signal and four EF-hand calcium binding loops. The protein is cytosolic at resting calcium levels; however, elevated intracellular calcium levels induce a conformational change that exposes the myristoyl group, resulting in protein association with membranes and partial co-localization with the perinuclear trans-golgi network. The protein is thought to be a regulator of G protein-coupled receptor signal transduction. Several alternatively spliced variants of this gene have been determined, all of which encode the same protein; additional variants may exist but their biological validity has not been determined.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
22,261 Da
NCBI Official Full Name
neurocalcin-delta
NCBI Official Synonym Full Names
neurocalcin delta
NCBI Official Symbol
NCALD
NCBI Official Synonym Symbols
neurocalcin-delta
NCBI Protein Information
neurocalcin-delta
UniProt Protein Name
Neurocalcin-delta
Protein Family
UniProt Gene Name
NCALD
Uniprot Description
May be involved in the calcium-dependent regulation of rhodopsin phosphorylation. Binds three calcium ions ().
Similar Products
Product Notes
The NCALD ncald (Catalog #AAA957470) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 2-193, Full length protein. The amino acid sequence is listed below: GKQNSKLRPE VMQDLLESTD FTEHEIQEWY KGFLRDCPSG HLSMEEFKKI YGNFFPYGDA SKFAEHVFRT FDANGDGTID FREFIIALSV TSRGKLEQKL KWAFSMYDLD GNGYISKSEM LEIVQAIYKM VSSVMKMPED ESTPEKRTEK IFRQMDTNRD GKLSLEEFIR GAKSDPSIVR LLQCDPSSAG QF. It is sometimes possible for the material contained within the vial of "Neurocalcin-delta (NCALD), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
