Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Neuroblastoma suppressor of tumorigenicity 1 (Nbl1) Recombinant Protein | Nbl1 recombinant protein

Recombinant Mouse Neuroblastoma suppressor of tumorigenicity 1 (Nbl1)

Gene Names
Nbl1; DAN; NO3; Dana; D4H1S1733E
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Neuroblastoma suppressor of tumorigenicity 1 (Nbl1); Recombinant Mouse Neuroblastoma suppressor of tumorigenicity 1 (Nbl1); Nbl1 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
17-178, full length protein
Sequence
APPPINKLALFPDKSAWCEAKNITQIVGHSGCEAKSIQNRACLGQCFSYSVPNTFPQSTESLVHCDSCMPAQSMWEIVTLECPGHEEVPRVDKLVEKIVHCSCQACGKEPSHEGLNVYVQGEDSPGSQPGPHSHAHPHPGGQTPEPEEPPGAPQVEEEGAED
Sequence Length
162
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Nbl1 recombinant protein
This gene product is the founding member of the evolutionarily conserved CAN (Cerberus and DAN) family of proteins, which contain a domain resembling the CTCK (C-terminal cystine knot-like) motif found in a number of signaling molecules. These proteins are secreted, and act as BMP (bone morphogenetic protein) antagonists by binding to BMPs and preventing them from interacting with their receptors. They may thus play an important role during growth and development. Alternatively spliced transcript variants encoding distinct isoforms have been identified for this gene.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
19,107 Da
NCBI Official Full Name
neuroblastoma suppressor of tumorigenicity 1
NCBI Official Synonym Full Names
neuroblastoma, suppression of tumorigenicity 1
NCBI Official Symbol
Nbl1
NCBI Official Synonym Symbols
DAN; NO3; Dana; D4H1S1733E
NCBI Protein Information
neuroblastoma suppressor of tumorigenicity 1
UniProt Protein Name
Neuroblastoma suppressor of tumorigenicity 1
UniProt Gene Name
Nbl1
UniProt Synonym Gene Names
Dan; Dana

Uniprot Description

Possible candidate as a tumor suppressor gene of neuroblastoma. May play an important role in preventing cells from entering the final stage (G1/S) of the transformation process.

Research Articles on Nbl1

Similar Products

Product Notes

The Nbl1 nbl1 (Catalog #AAA1421149) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 17-178, full length protein. The amino acid sequence is listed below: APPPINKLAL FPDKSAWCEA KNITQIVGHS GCEAKSIQNR ACLGQCFSYS VPNTFPQSTE SLVHCDSCMP AQSMWEIVTL ECPGHEEVPR VDKLVEKIVH CSCQACGKEP SHEGLNVYVQ GEDSPGSQPG PHSHAHPHPG GQTPEPEEPP GAPQVEEEGA ED. It is sometimes possible for the material contained within the vial of "Neuroblastoma suppressor of tumorigenicity 1 (Nbl1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.