Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Nanos homolog 2 (Nanos2) Recombinant Protein | Nanos2 recombinant protein

Recombinant Mouse Nanos homolog 2 (Nanos2)

Gene Names
Nanos2; nos2
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Nanos homolog 2 (Nanos2); Recombinant Mouse Nanos homolog 2 (Nanos2); Nanos2 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-136, Full length protein
Sequence
MDLPPFDMWRDYFNLSQVVMDIIQSRKQRQEGEVAEEPNSRPQEKSEQDLEGYPGCLPTICNFCKHNGESRHVYTSHQLKTPEGVVVCPILRHYVCPLCGATGDQAHTLKYCPLNSSQQSLYRRSGRNSAGRRVKR
Sequence Length
136
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
15,597 Da
NCBI Official Full Name
nanos homolog 2
NCBI Official Synonym Full Names
nanos C2HC-type zinc finger 2
NCBI Official Symbol
Nanos2
NCBI Official Synonym Symbols
nos2
NCBI Protein Information
nanos homolog 2
UniProt Protein Name
Nanos homolog 2
Protein Family
UniProt Gene Name
Nanos2
UniProt Synonym Gene Names
Nos2; NOS-2

Uniprot Description

Plays a key role in the sexual differentiation of germ cells by promoting the male fate but suppressing the female fate. Represses the female fate pathways by suppressing meiosis, which in turn results in the promotion of the male fate. Maintains the suppression of meiosis by preventing STRA8 expression, which is required for premeiotic DNA replication, after CYP26B1 is decreased. Regulates the localization of the CCR4-NOT deadenylation complex to P-bodies and plays a role in recruiting the complex to trigger the degradation of mRNAs involved in meiosis. Required for the maintenance of the spermatogonial stem cell population. Not essential for the assembly of P-bodies but is required for the maintenance of their normal state.

Research Articles on Nanos2

Similar Products

Product Notes

The Nanos2 nanos2 (Catalog #AAA968471) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-136, Full length protein. The amino acid sequence is listed below: MDLPPFDMWR DYFNLSQVVM DIIQSRKQRQ EGEVAEEPNS RPQEKSEQDL EGYPGCLPTI CNFCKHNGES RHVYTSHQLK TPEGVVVCPI LRHYVCPLCG ATGDQAHTLK YCPLNSSQQS LYRRSGRNSA GRRVKR. It is sometimes possible for the material contained within the vial of "Nanos homolog 2 (Nanos2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.