Uncharacterized protein C12orf28 (C12orf28) Recombinant Protein | C12orf28 recombinant protein
Recombinant Human Uncharacterized protein C12orf28 (C12orf28)
Gene Names
MYRFL; bcm1377; C12orf15; C12orf28
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Uncharacterized protein C12orf28 (C12orf28); Recombinant Human Uncharacterized protein C12orf28 (C12orf28); C12orf28 recombinant protein
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
20-275aa; full length protein
Sequence
DRRVPNLPPSNITSSQEPALLPTASSSAPNTSLVTTPASLQVPEITFCEILPCQETYCCP IRGMKEVSSSPVQRQSEEKEFHQRRWSEDKSKSVLARNALSGPDWESDWIDTTISSIQIM EIQQIIDHQYCIQSLQCGSGNYNYNIPVNKHTPTNVKFSLEINTTEPLIVFQCKFTLGNI CFHSKRGTKGMESHREISQEMTQGYQHIWSLPVAPFSDSMFHFRVAAPDLADCSTDPYFA GIFFTDYFFYFYRRCA
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Human
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for C12orf28 recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
101,670 Da
NCBI Official Full Name
myelin regulatory factor-like protein
NCBI Official Synonym Full Names
myelin regulatory factor-like
NCBI Official Symbol
MYRFL
NCBI Official Synonym Symbols
bcm1377; C12orf15; C12orf28
NCBI Protein Information
myelin regulatory factor-like protein
UniProt Protein Name
Myelin regulatory factor-like protein
UniProt Gene Name
MYRFL
UniProt Synonym Gene Names
C12orf15; C12orf28
UniProt Entry Name
MRFL_HUMAN
Uniprot Description
MYRFL: Belongs to the MRF family
Protein type: Secreted, signal peptide; Secreted
Chromosomal Location of Human Ortholog: 12q15
Cellular Component: integral to membrane
Molecular Function: DNA binding; transcription factor activity
Biological Process: regulation of transcription, DNA-dependent
Similar Products
Product Notes
The C12orf28 myrfl (Catalog #AAA7010514) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 20-275aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the C12orf28 myrfl for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: DRRVPNLPPS NITSSQEPAL LPTASSSAPN TSLVTTPASL QVPEITFCEI LPCQETYCCP IRGMKEVSSS PVQRQSEEKE FHQRRWSEDK SKSVLARNAL SGPDWESDWI DTTISSIQIM EIQQIIDHQY CIQSLQCGSG NYNYNIPVNK HTPTNVKFSL EINTTEPLIV FQCKFTLGNI CFHSKRGTKG MESHREISQE MTQGYQHIWS LPVAPFSDSM FHFRVAAPDL ADCSTDPYFA GIFFTDYFFY FYRRCA. It is sometimes possible for the material contained within the vial of "Uncharacterized protein C12orf28 (C12orf28), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
