Mucin-2 (MUC2) Recombinant Protein | MUC2 recombinant protein

Recombinant Human Mucin-2 (MUC2), partial

Cat. Num. AAA958652

• Gene Names: MUC2; MLP; SMUC; MUC-2
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Mucin-2 (MUC2); Recombinant Human Mucin-2 (MUC2); partial; Intestinal mucin-2; MUC2 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 36-240aa; Partial, provide VWFD 1 Domain.
• Sequence: VCSTWGNFHYKTFDGDVFRFPGLCDYNFASDCRGSYKEFAVHLKRGPGQAEAPAGVESILLTIKDDTIYLTRHLAVLNGAVVSTPHYSPGLLIEKSDAYTKVYSRAGLTLMWNREDALMLELDTKFRNHTCGLCGDYNGLQSYSEFLSDGVLFSPLEFGNMQKINQPDVVCEDPEEEVAPASCSEHRAECERLLTAEAFADCQDL

• Production Note: Special Offer: The E Coli host-expressed protein is manufactured from a stock plasmid containing the protein gene. E Colihost-expressed protein is stocked in different unit sizes ranging from as small as 10 ug to as large as 1 mg. Bulk inventory is also available. The E Coli host-expressed protein has been ordered over and over again by researchers and has stood the test of time as both a robust protein and important target for the research community. It is part of our new program to make our most popular protein targets and corresponding hosts available in expanded unit sizes and with a quick processing time. Select E Coli host-expressed protein for the fastest delivery among all hosts. Please contact our technical support team or email to [email protected] for more details.
• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

Related Product Information for MUC2 recombinant protein

Coats the epithelia of the intestines, airways, and other mucus membrane-containing organs. Thought to provide a protective, lubricating barrier against particles and infectious agents at mucosal surfaces. Major constituent of both the inner and outer mucus layers of the colon and may play a role in excluding bacteria from the inner mucus layer.

Product Categories/Family for MUC2 recombinant protein

Signal Transduction

References

Molecular cloning of human intestinal mucin (MUC2) cDNA. Identification of the amino terminus and overall sequence similarity to prepro-von Willebrand factor.Gum J.R. Jr., Hicks J.W., Toribara N.W., Siddiki B., Kim Y.S.J. Biol. Chem. 269:2440-2446(1994) The human MUC2 intestinal mucin has cysteine-rich subdomains located both upstream and downstream of its central repetitive region.Gum J.R. Jr., Hicks J.W., Toribara N.W., Rothe E.-M., Lagace R.E., Kim Y.S.J. Biol. Chem. 267:21375-21383(1992) MUC-2 human small intestinal mucin gene structure. Repeated arrays and polymorphism.Toribara N.W., Gum J.R. Jr., Culhane P.J., Lagace R.E., Hicks J.W., Petersen G.M., Kim Y.S.J. Clin. Invest. 88:1005-1013(1991) Molecular cloning of human intestinal mucin cDNAs. Sequence analysis and evidence for genetic polymorphism.Gum J.R. Jr., Byrd J.C., Hicks J.W., Toribara N.W., Lamport D.T.A., Kim Y.S.J. Biol. Chem. 264:6480-6487(1989) Human intestinal mucin-like protein (MLP) is homologous with rat MLP in the C-terminal region, and is encoded by a gene on chromosome 11 p 15.5.Xu G., Huan L., Khatri I., Sajjan U.S., McCool D., Wang D., Jones C., Forstner G., Forstner J.Biochem. Biophys. Res. Commun. 183:821-828(1992) In vivo glycosylation of mucin tandem repeats.Silverman H.S., Parry S., Sutton-Smith M., Burdick M.D., McDermott K., Reid C.J., Batra S.K., Morris H.R., Hollingsworth M.A., Dell A., Harris A.Glycobiology 11:459-471(2001) The N terminus of the MUC2 mucin forms trimers that are held together within a trypsin-resistant core fragment.Godl K., Johansson M.E.V., Lidell M.E., Moergelin M., Karlsson H., Olson F.J., Gum J.R. Jr., Kim Y.S., Hansson G.C.J. Biol. Chem. 277:47248-47256(2002) An autocatalytic cleavage in the C terminus of the human MUC2 mucin occurs at the low pH of the late secretory pathway.Lidell M.E., Johansson M.E.V., Hansson G.C.J. Biol. Chem. 278:13944-13951(2003) A quantitative atlas of mitotic phosphorylation.Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P.Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) The protein disulfide isomerase AGR2 is essential for production of intestinal mucus.Park S.-W., Zhen G., Verhaeghe C., Nakagami Y., Nguyenvu L.T., Barczak A.J., Killeen N., Erle D.J.Proc. Natl. Acad. Sci. U.S.A. 106:6950-6955(2009) Proteomic analyses of the two mucus layers of the colon barrier reveal that their main component, the Muc2 mucin, is strongly bound to the Fcgbp protein.Johansson M.E.V., Thomsson K.A., Hansson G.C.J. Proteome Res. 8:3549-3557(2009)

NCBI and Uniprot Product Information

• NCBI GI #: 557129045
• NCBI GeneID: 4583
• NCBI Accession #: NP_002448.3
• NCBI GenBank Nucleotide #: NM_002457.3
• UniProt Accession #: Q02817; Q14878
• Molecular Weight: 24.8 kDa
• NCBI Official Full Name: mucin-2
• NCBI Official Synonym Full Names: mucin 2, oligomeric mucus/gel-forming
• NCBI Official Symbol: MUC2
• NCBI Official Synonym Symbols: MLP; SMUC; MUC-2
• NCBI Protein Information: mucin-2
• UniProt Protein Name: Mucin-2
• Protein Family: Mucin
• UniProt Gene Name: MUC2
• UniProt Synonym Gene Names: SMUC; MUC-2
• UniProt Entry Name: MUC2_HUMAN

NCBI Description

This gene encodes a member of the mucin protein family. Mucins are high molecular weight glycoproteins produced by many epithelial tissues. The protein encoded by this gene is secreted and forms an insoluble mucous barrier that protects the gut lumen. The protein polymerizes into a gel of which 80% is composed of oligosaccharide side chains by weight. The protein features a central domain containing tandem repeats rich in threonine and proline that varies between 50 and 115 copies in different individuals. Alternatively spliced transcript variants of this gene have been described, but their full-length nature is not known. [provided by RefSeq, Jul 2008]

Uniprot Description

MUC2: Coats the epithelia of the intestines, airways, and other mucus membrane-containing organs. Thought to provide a protective, lubricating barrier against particles and infectious agents at mucosal surfaces. Major constituent of both the inner and outer mucus layers of the colon and may play a role in excluding bacteria from the inner mucus layer.

Protein type: Extracellular matrix; Secreted, signal peptide; Secreted

Chromosomal Location of Human Ortholog: 11p15.5

Cellular Component: Golgi lumen

Molecular Function: protein binding

Biological Process: cellular protein metabolic process; maintenance of gastrointestinal epithelium; O-glycan processing; post-translational protein modification; protein amino acid O-linked glycosylation