PTS system mannitol-specific EIICB component (mtlA) Recombinant Protein | mtlA recombinant protein
Recombinant PTS system mannitol-specific EIICB component (mtlA)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
PTS system mannitol-specific EIICB component (mtlA); Recombinant PTS system mannitol-specific EIICB component (mtlA); mtlA recombinant protein
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-589aa; full length protein
Sequence
MERKSSLKVRVQKLGTSLSNMVMPNIGAFIAWGVAASLFIATGYLPNKALDTNVVGPMLK YVLPLLIGYTGGYNIHKQRGGVIGAIASFGAIAGSTVTMFIGAMIMGPLSAWILKKFDEK VQPKIRTGFEMLVNNFSLGLIGFALMVLAFFVIGPVVAQLTEWVGIGVEAIVKVHLLPLA NLIIEPAKILFLNNALNHGIFTPLGTEQVAKVGKSVLFLLEANPGPGLGVLIAYAMFGKG SAKSSSWGAMIIHFFGGIHEIYFPYVMMKPAMFLAVIAGGLTGTFTFQTLGAGLTAPASP GSIIAIMGMSPKGWGPHLVVLAGVFAAAVASFLVASIILKSDNSDDDSLETAQAVTQAAK AESKGQAVTEPNLHSDITTDNIHQIIFACDAGMGSSAMGASILRDKVKKAGLDISVSNQA ISNLQDTANTLIVTQEELADRAGQKTPRAVHVAVDNFLATSKYDDIIASLTNGKASGSEN AAHSTQADSAEIDLNQIDAVVFAYGIAKGSATMGQETLRSIFKQNNVKIPVSTASYAHLS DYNAKNILLVTTIAQQGQAQQAAPNAQILVVDSLVTTPEYDKLVARMHK
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Streptococcus mutans
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for mtlA recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
62,035 Da
NCBI Official Full Name
PTS system mannitol-specific transporter subunit IIBC
NCBI Official Symbol
mtlA1
NCBI Protein Information
PTS system mannitol-specific transporter subunit IIBC
UniProt Protein Name
PTS system mannitol-specific EIICB component
Protein Family
UniProt Gene Name
mtlA
UniProt Synonym Gene Names
EII-Mtl
UniProt Entry Name
PTMCB_STRMU
Uniprot Description
The phosphoenolpyruvate-dependent sugar phosphotransferase system (sugar PTS), a major carbohydrate active transport system, catalyzes the phosphorylation of incoming sugar substrates concomitantly with their translocation across the cell membrane. The enzyme II CmtAB PTS system is involved in D-mannitol transport.
Similar Products
Product Notes
The mtlA mtla (Catalog #AAA7021994) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-589aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the mtlA mtla for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MERKSSLKVR VQKLGTSLSN MVMPNIGAFI AWGVAASLFI ATGYLPNKAL DTNVVGPMLK YVLPLLIGYT GGYNIHKQRG GVIGAIASFG AIAGSTVTMF IGAMIMGPLS AWILKKFDEK VQPKIRTGFE MLVNNFSLGL IGFALMVLAF FVIGPVVAQL TEWVGIGVEA IVKVHLLPLA NLIIEPAKIL FLNNALNHGI FTPLGTEQVA KVGKSVLFLL EANPGPGLGV LIAYAMFGKG SAKSSSWGAM IIHFFGGIHE IYFPYVMMKP AMFLAVIAGG LTGTFTFQTL GAGLTAPASP GSIIAIMGMS PKGWGPHLVV LAGVFAAAVA SFLVASIILK SDNSDDDSLE TAQAVTQAAK AESKGQAVTE PNLHSDITTD NIHQIIFACD AGMGSSAMGA SILRDKVKKA GLDISVSNQA ISNLQDTANT LIVTQEELAD RAGQKTPRAV HVAVDNFLAT SKYDDIIASL TNGKASGSEN AAHSTQADSA EIDLNQIDAV VFAYGIAKGS ATMGQETLRS IFKQNNVKIP VSTASYAHLS DYNAKNILLV TTIAQQGQAQ QAAPNAQILV VDSLVTTPEY DKLVARMHK. It is sometimes possible for the material contained within the vial of "PTS system mannitol-specific EIICB component (mtlA), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
