Translation initiation factor IF-3, mitochondrial (MTIF3) Recombinant Protein | MTIF3 recombinant protein

Recombinant Human Translation initiation factor IF-3, mitochondrial (MTIF3)

Cat. Num. AAA1330080

• Gene Names: MTIF3; IF3mt
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Translation initiation factor IF-3; mitochondrial (MTIF3); Recombinant Human Translation initiation factor IF-3; mitochondrial; IF-3(Mt); IF-3Mt; IF3(mt); IF3mt; MTIF3 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-278aa; Full Length
• Sequence: TAPAQLSPIASAPRLSFLIHAKAFSTAEDTQNEGKKTKKNKTAFSNVGRKISQRVIHLFDEKGNDLGNMHRANVIRLMDERDLRLVQRNTSTEPAEYQLMTGLQILQERQRLREMEKANPKTGPTLRKELILSSNIGQHDLDTKTKQIQQWIKKKHLVQITIKKGKNVDVSENEMEEIFHQILQTMPGIATFSSRPQAVQGGKALMCVLRAFSKNEEKAYKETQETQERDTLNKDHGNDKESNVLHQ
• Sequence Length: 247

• Species: Homo sapiens (Human)
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

SDS-PAGE

Related Product Information for MTIF3 recombinant protein

IF-3 binds to the 28S ribosomal subunit and shifts the equilibrum between 55S ribosomes and their 39S and 28S subunits in favor of the free subunits, thus enhancing the availability of 28S subunits on which protein synthesis initiation begins.

Product Categories/Family for MTIF3 recombinant protein

Neuroscience

NCBI and Uniprot Product Information

• NCBI GI #: 261878554
• NCBI GeneID: 219402
• NCBI Accession #: NP_001159733.1
• NCBI GenBank Nucleotide #: NM_001166261.1
• UniProt Accession #: Q9H2K0; Q05BL8; Q5W0V0; Q86X68
• Molecular Weight: 55.2 kDa
• NCBI Official Full Name: translation initiation factor IF-3, mitochondrial
• NCBI Official Synonym Full Names: mitochondrial translational initiation factor 3
• NCBI Official Symbol: MTIF3
• NCBI Official Synonym Symbols: IF3mt
• NCBI Protein Information: translation initiation factor IF-3, mitochondrial; IF-3(Mt)
• UniProt Protein Name: Translation initiation factor IF-3, mitochondrial
• UniProt Gene Name: MTIF3
• UniProt Synonym Gene Names: IF-3(Mt); IF-3Mt; IF3(mt); IF3mt
• UniProt Entry Name: IF3M_HUMAN

NCBI Description

This gene encodes a translation initiation factor that is involved in mitochondrial protein synthesis. Polymorphism in this gene is associated with the onset of Parkinson's disease. Alternate splicing results in multiple transcript variants. A pseudogene of this gene is found on chromosome 5. [provided by RefSeq, Oct 2009]

Uniprot Description

MTIF3: IF-3 binds to the 28S ribosomal subunit and shifts the equilibrum between 55S ribosomes and their 39S and 28S subunits in favor of the free subunits, thus enhancing the availability of 28S subunits on which protein synthesis initiation begins. Belongs to the IF-3 family.

Protein type: Translation initiation; Translation; Mitochondrial

Chromosomal Location of Human Ortholog: 13q12.2

Cellular Component: mitochondrion

Molecular Function: translation factor activity, nucleic acid binding; translation initiation factor activity; ribosomal small subunit binding

Biological Process: mitochondrial translation; organelle organization and biogenesis; ribosome disassembly