Probable G-protein coupled receptor Mth-like 12 (mthl12) Recombinant Protein | mthl12 recombinant protein
Recombinant Drosophila melanogaster Probable G-protein coupled receptor Mth-like 12 (mthl12)
Gene Names
mthl12; CG32853; DmelCG32853; Mthl12
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Probable G-protein coupled receptor Mth-like 12 (mthl12); Recombinant Drosophila melanogaster Probable G-protein coupled receptor Mth-like 12 (mthl12); Recombinant Probable G-protein coupled receptor Mth-like 12 (mthl12); Probable G-protein coupled receptor Mth-like 12; Protein methuselah-like 12; mthl12 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
18-488
Sequence
KNSSAKIPHCKYDETINISHFKRLNDAYIYEHFEIPANLTGEFDYKELMDGSKVPTEFPNLRGCICKVRPCIRICCARKNILSNGECSDGVKNEIKLTMLDLTMQDILLTDPTLAELNMIPQYNSTELLILREQFQPCDEIVSLKRDEYTILKDGSILLHTSAEILSNDQYCLYPEIYSDFPETIRIINRRCYRNVMPGIAQLSVISVVGFILTLAVYLSVEKLRNLLGKCLICSLFSMFMEYFIWTMDYFRLLQSICSAAGYMKYFFSMSSYLWFSVVSFHLWELFTSLNRHEPQYRFLIYNTFVWCTAAIPTVVIFSMNQMWENDPGKSEWLPLVGYFGCSVKDWNSSSWFYSHIPIVILNSFNVIMFVLTAIYIWKVKKGVKSFAQHDERNTTCLEFNVQTYIQFVRLFLIMGASWLLDQLTRLAEDSHLLLDTIVLNLTVYLNAAFGILIFVLLILKGSTFKMIMER
Sequence Length
488
Species
Drosophila melanogaster (Fruit fly)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
56,781 Da
NCBI Official Full Name
methuselah-like 12
NCBI Official Synonym Full Names
methuselah-like 12
NCBI Official Symbol
mthl12
NCBI Official Synonym Symbols
CG32853; DmelCG32853; Mthl12
NCBI Protein Information
CG32853 gene product from transcript CG32853-RA; CG32853-PA; Mth-like 12; Mth-like-12; methuselah-like 12; mthl12-PA
UniProt Protein Name
Probable G-protein coupled receptor Mth-like 12
Protein Family
UniProt Gene Name
mthl12
UniProt Synonym Gene Names
Mth-like-12
UniProt Entry Name
MTH12_DROME
Uniprot Description
Subcellular location: Cell membrane; Multi-pass membrane protein
Potential.
Sequence similarities: Belongs to the G-protein coupled receptor 2 family. Mth subfamily.
Similar Products
Product Notes
The mthl12 mthl12 (Catalog #AAA1215568) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 18-488. The amino acid sequence is listed below: KNSSAKIPHC KYDETINISH FKRLNDAYIY EHFEIPANLT GEFDYKELMD GSKVPTEFPN LRGCICKVRP CIRICCARKN ILSNGECSDG VKNEIKLTML DLTMQDILLT DPTLAELNMI PQYNSTELLI LREQFQPCDE IVSLKRDEYT ILKDGSILLH TSAEILSNDQ YCLYPEIYSD FPETIRIINR RCYRNVMPGI AQLSVISVVG FILTLAVYLS VEKLRNLLGK CLICSLFSMF MEYFIWTMDY FRLLQSICSA AGYMKYFFSM SSYLWFSVVS FHLWELFTSL NRHEPQYRFL IYNTFVWCTA AIPTVVIFSM NQMWENDPGK SEWLPLVGYF GCSVKDWNSS SWFYSHIPIV ILNSFNVIMF VLTAIYIWKV KKGVKSFAQH DERNTTCLEF NVQTYIQFVR LFLIMGASWL LDQLTRLAED SHLLLDTIVL NLTVYLNAAF GILIFVLLIL KGSTFKMIME R. It is sometimes possible for the material contained within the vial of "Probable G-protein coupled receptor Mth-like 12 (mthl12), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
