Transcription termination factor, mitochondrial (MTERF) Recombinant Protein | MTERF recombinant protein

Recombinant Human Transcription termination factor, mitochondrial (MTERF)

Cat. Num. AAA1324208

• Gene Names: MTERF1; MTERF
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Transcription termination factor; mitochondrial (MTERF); Recombinant Human Transcription termination factor; MTERF recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 58-399, Full length protein
• Sequence: FGVKCHNTDSEPLKNEDLLKNLLTMGVDIDMARKRQPGVFHRMITNEQDLKMFLLSKGASKEVIASIISRYPRAITRTPENLSKRWDLWRKIVTSDLEIVNILERSPESFFRSNNNLNLENNIKFLYSVGLTRKCLCRLLTNAPRTFSNSLDLNKQMVEFLQAAGLSLGHNDPADFVRKIIFKNPFILIQSTKRVKANIEFLRSTFNLNSEELLVLICGPGAEILDLSNDYARRSYANIKEKLFSLGCTEEEVQKFVLSYPDVIFLAEKKFNDKIDCLMEENISISQIIENPRVLDSSISTLKSRIKELVNAGCNLSTLNITLLSWSKKRYEAKLKKLSRFA
• Sequence Length: 342

• Species: Human
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

Related Product Information for MTERF recombinant protein

This gene encodes a mitochondrial transcription termination factor. This protein participates in attenuating transcription from the mitochondrial genome; this attenuation allows higher levels of expression of 16S ribosomal RNA relative to the tRNA gene downstream. The product of this gene has three leucine zipper motifs bracketed by two basic domains that are all required for DNA binding. There is evidence that, for this protein, the zippers participate in intramolecular interactions that establish the three-dimensional structure required for DNA binding.

NCBI and Uniprot Product Information

• NCBI GI #: 667477562
• NCBI GeneID: 7978
• NCBI Accession #: NP_001288063.1
• NCBI GenBank Nucleotide #: NM_001301134.1
• UniProt Accession #: Q99551; Q32NF8; Q53H51; Q9BVR7; A4D1E3
• Molecular Weight: 45,778 Da
• NCBI Official Full Name: transcription termination factor 1, mitochondrial isoform 2
• NCBI Official Synonym Full Names: mitochondrial transcription termination factor 1
• NCBI Official Symbol: MTERF1
• NCBI Official Synonym Symbols: MTERF
• NCBI Protein Information: transcription termination factor 1, mitochondrial
• UniProt Protein Name: Transcription termination factor 1, mitochondrial
• UniProt Gene Name: MTERF1
• UniProt Synonym Gene Names: MTERF; mTERF; mTERF1

NCBI Description

This gene encodes a mitochondrial transcription termination factor. This protein participates in attenuating transcription from the mitochondrial genome; this attenuation allows higher levels of expression of 16S ribosomal RNA relative to the tRNA gene downstream. The product of this gene has three leucine zipper motifs bracketed by two basic domains that are all required for DNA binding. There is evidence that, for this protein, the zippers participate in intramolecular interactions that establish the three-dimensional structure required for DNA binding. [provided by RefSeq, Jul 2008]

Uniprot Description

Transcription termination factor. Binds to a 28 bp region within the tRNA(Leu(uur)) gene at a position immediately adjacent to and downstream of the 16S rRNA gene; this region comprises a tridecamer sequence critical for directing accurate termination. Binds DNA along the major grove and promotes DNA bending and partial unwinding. Promotes base flipping. Transcription termination activity appears to be polarized with highest specificity for transcripts initiated on the light strand.