Cytochrome b (MT-CYB) Recombinant Protein | MT-CYB recombinant protein
Recombinant Rabbit Cytochrome b (MT-CYB), partial
Gene Names
CYTB; cytb
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Cytochrome b (MT-CYB); Recombinant Rabbit Cytochrome b (MT-CYB); partial; MT-CYB recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-379
Sequence
MTNIRKTHPLLKIVNHSLIDLPAPSNISAWWNFGSLLGLCLMIQIFTGLFLAMHYTSDTTTAFSSVTHICRDVNYGWLIRYLHANGASMFFICLYMHVGRGIYYGSYTYLETWNIGIILLFAVMATAFMGYVLPWGQMSFWGATVITNLLSAIPYIGTTLVEWIWGGFSVDKATLTRFFAFHFILPFIIATLVLIHLLFLHETGSNNPTGIPSNSDKIPFHPYYTIKDTLGFLVAILLLLILVLFSPDLLGDPDNYTPANPLNTPPHIKPEWYFLFAYAILRSIPNKLGGVLALVLSILVLAFIPFLHMSKQRSMMFRPISQVLFWVLVADLLTLTWIGGQPVEHPFITIGQVASVLYFTTILILMPLASLIENKILKW
Sequence Length
379
Species
Oryctolagus cuniculus (Rabbit)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
42,786 Da
NCBI Official Full Name
cytochrome b, partial (mitochondrion)
NCBI Official Symbol
CYTB
NCBI Official Synonym Symbols
cytb
NCBI Protein Information
cytochrome b
UniProt Protein Name
Cytochrome b
UniProt Gene Name
MT-CYB
UniProt Synonym Gene Names
COB; CYTB; MTCYB
Uniprot Description
Component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex) that is part of the mitochondrial respiratory chain. The b-c1 complex mediates electron transfer from ubiquinol to cytochrome c. Contributes to the generation of a proton gradient across the mitochondrial membrane that is then used for ATP synthesis.
Research Articles on MT-CYB
Similar Products
Product Notes
The MT-CYB mt-cyb (Catalog #AAA950092) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-379. The amino acid sequence is listed below: MTNIRKTHPL LKIVNHSLID LPAPSNISAW WNFGSLLGLC LMIQIFTGLF LAMHYTSDTT TAFSSVTHIC RDVNYGWLIR YLHANGASMF FICLYMHVGR GIYYGSYTYL ETWNIGIILL FAVMATAFMG YVLPWGQMSF WGATVITNLL SAIPYIGTTL VEWIWGGFSV DKATLTRFFA FHFILPFIIA TLVLIHLLFL HETGSNNPTG IPSNSDKIPF HPYYTIKDTL GFLVAILLLL ILVLFSPDLL GDPDNYTPAN PLNTPPHIKP EWYFLFAYAI LRSIPNKLGG VLALVLSILV LAFIPFLHMS KQRSMMFRPI SQVLFWVLVA DLLTLTWIGG QPVEHPFITI GQVASVLYFT TILILMPLAS LIENKILKW. It is sometimes possible for the material contained within the vial of "Cytochrome b (MT-CYB), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
