Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

ATP synthase subunit a (MT-ATP6) Recombinant Protein | MT-ATP6 recombinant protein

Recombinant Cricetulus griseus ATP synthase subunit a (MT-ATP6)

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
ATP synthase subunit a (MT-ATP6); Recombinant Cricetulus griseus ATP synthase subunit a (MT-ATP6); Recombinant ATP synthase subunit a (MT-ATP6); ATP synthase subunit a; F-ATPase protein 6; MT-ATP6 recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-226
Sequence
MNENLFSSFITPTLMGLPIIILIIMFPPVIMTSSKRLVNNRFHTFQQWLIKLITKQMMAIHSPKGRTWSLMLASLIIFIGSTNLLGLLPHTFTPTTQLSMNLGMAIPPWAGAVILGFRHKMKDSLAHFLPQGTPIPLIPMLVIIETISLFIQPMALAVRLTANITAGHLLMHLIGGATLVLTSISLPTAMITFIILIMLTILEFAVALIQAYVFTLLVSLYLHDNT
Sequence Length
226
Species
Cricetulus griseus (Chinese hamster) (Cricetulus barabensis griseus)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

NCBI GI #
UniProt Accession #
Molecular Weight
25,040 Da
NCBI Official Full Name
ATP synthase subunit a
UniProt Protein Name
ATP synthase subunit a
UniProt Gene Name
MT-ATP6
UniProt Synonym Gene Names
ATP6; ATPASE6; MTATP6
UniProt Entry Name
ATP6_CRIGR

Uniprot Description

Function: Mitochondrial membrane ATP synthase (F1F0 ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F1 - containing the extramembraneous catalytic core and F0 - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F1 is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Key component of the proton channel; it may play a direct role in the translocation of protons across the membrane.

Subunit structure: F-type ATPases have 2 components, CF1 - the catalytic core - and CF0 - the membrane proton channel. CF1 has five subunits: alpha3, beta3, gamma1, delta1, epsilon1. CF0 has three main subunits: a, b and c. Component of an ATP synthase complex composed of ATP5F1, ATP5G1, ATP5E, ATP5H, ATP5I, ATP5J, ATP5J2, MT-ATP6, MT-ATP8, ATP5A1, ATP5B, ATP5D, ATP5C1, ATP5O, ATP5L, USMG5 and MP68

By similarity.

Subcellular location: Mitochondrion inner membrane; Multi-pass membrane protein.

Sequence similarities: Belongs to the ATPase A chain family.

Similar Products

Product Notes

The ATP synthase subunit a (MT-ATP6) mt-atp6 (Catalog #AAA1207234) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-226. The amino acid sequence is listed below: MNENLFSSFI TPTLMGLPII ILIIMFPPVI MTSSKRLVNN RFHTFQQWLI KLITKQMMAI HSPKGRTWSL MLASLIIFIG STNLLGLLPH TFTPTTQLSM NLGMAIPPWA GAVILGFRHK MKDSLAHFLP QGTPIPLIPM LVIIETISLF IQPMALAVRL TANITAGHLL MHLIGGATLV LTSISLPTAM ITFIILIMLT ILEFAVALIQ AYVFTLLVSL YLHDNT. It is sometimes possible for the material contained within the vial of "ATP synthase subunit a (MT-ATP6), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.