UPF0041 protein F53F10.3 (F53F10.3) Recombinant Protein | F53F10.3 recombinant protein
Recombinant UPF0041 protein F53F10.3 (F53F10.3)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
UPF0041 protein F53F10.3 (F53F10.3); Recombinant UPF0041 protein F53F10.3 (F53F10.3); UPF0041 protein F53F10.3; F53F10.3 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-133
Sequence
MGPHRLLYQALCKAGDKFVYPVLPAFAKPAWNHAAGPKTVFFWAPTIKWTLIGAGLADLARPADKLSLYQNSALFATGAIWTRYCLVITPINYYLSSVNFFVMCTGLAQLCRIAHYRYQNPDWETKEIMETHN
Sequence Length
133
Species
Caenorhabditis elegans
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
15,074 Da
NCBI Official Full Name
Protein F53F10.3
NCBI Official Symbol
F53F10.3
NCBI Protein Information
Protein F53F10.3
UniProt Protein Name
Probable mitochondrial pyruvate carrier 1
Protein Family
UniProt Gene Name
MPC1
UniProt Synonym Gene Names
MPC1
UniProt Entry Name
MPC1_CAEEL
Uniprot Description
Function: May mediate the uptake of pyruvate into mitochondria
By similarity.
Subcellular location: Mitochondrion inner membrane
By similarity; Multi-pass membrane protein.
Sequence similarities: Belongs to the mitochondrial pyruvate carrier (MPC) family.
Similar Products
Product Notes
The F53F10.3 mpc1 (Catalog #AAA1188763) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-133. The amino acid sequence is listed below: MGPHRLLYQA LCKAGDKFVY PVLPAFAKPA WNHAAGPKTV FFWAPTIKWT LIGAGLADLA RPADKLSLYQ NSALFATGAI WTRYCLVITP INYYLSSVNF FVMCTGLAQL CRIAHYRYQN PDWETKEIME THN. It is sometimes possible for the material contained within the vial of "UPF0041 protein F53F10.3 (F53F10.3), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
