Wnt3a blocking peptide
Wnt3a Peptide - C-terminal region
Gene Names
Wnt3a; vt; Wnt-3a
Reactivity
Mouse
Applications
Immunohistochemistry, Western Blot
Synonyms
Wnt3a; Wnt3a Peptide - C-terminal region; Wnt3a blocking peptide
Reactivity
Mouse
Form/Format
Lyophilized powder
Sequence
IGDFLKDKYDSASEMVVEKHRESRGWVETLRPRYTYFKVPTERDLVYYEA
Sequence Length
352
Applicable Applications for Wnt3a blocking peptide
Immunohistochemistry (IHC), Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for Wnt3a blocking peptide
This is a synthetic peptide designed for use in combination with anti-Wnt3a Antibody, made
Target Description: Wnt3a is a ligand for members of the frizzled family of seven transmembrane receptors. Wnt-3 and Wnt-3a play distinct roles in cell-cell signaling during morphogenesis of the developing neural tube.
Target Description: Wnt3a is a ligand for members of the frizzled family of seven transmembrane receptors. Wnt-3 and Wnt-3a play distinct roles in cell-cell signaling during morphogenesis of the developing neural tube.
Product Categories/Family for Wnt3a blocking peptide
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
38kDa
NCBI Official Full Name
protein Wnt-3a
NCBI Official Synonym Full Names
wingless-type MMTV integration site family, member 3A
NCBI Official Symbol
Wnt3a
NCBI Official Synonym Symbols
vt; Wnt-3a
NCBI Protein Information
protein Wnt-3a
UniProt Protein Name
Protein Wnt-3a
UniProt Gene Name
Wnt3a
UniProt Synonym Gene Names
Wnt-3a
Uniprot Description
Ligand for members of the frizzled family of seven transmembrane receptors. Wnt-3 and Wnt-3a play distinct roles in cell-cell signaling during morphogenesis of the developing neural tube.
Research Articles on Wnt3a
Similar Products
Product Notes
The Wnt3a wnt3a (Catalog #AAA3239006) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The Wnt3a Peptide - C-terminal region reacts with Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's Wnt3a can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the Wnt3a wnt3a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: IGDFLKDKYD SASEMVVEKH RESRGWVETL RPRYTYFKVP TERDLVYYEA. It is sometimes possible for the material contained within the vial of "Wnt3a, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
