Slc22a3 blocking peptide
Slc22a3 Peptide - middle region
Gene Names
Slc22a3; EMT; Oct3; Orct3; Slca22a3
Reactivity
Mouse
Applications
Western Blot
Synonyms
Slc22a3; Slc22a3 Peptide - middle region; Slc22a3 blocking peptide
Reactivity
Mouse
Form/Format
Lyophilized powder
Sequence
TSSELSCDPLTAFPNRSAPLVSCSGDWRYVETHSTIVSQFDLVCSNAWML
Sequence Length
551
Applicable Applications for Slc22a3 blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for Slc22a3 blocking peptide
This is a synthetic peptide designed for use in combination with anti-Slc22a3 Antibody, made
Target Description: Slc22a3 mediates potential-dependent transport of a variety of organic cations. It may play a significant role in the disposition of cationic neurotoxins and neurotransmitters in the brain.
Target Description: Slc22a3 mediates potential-dependent transport of a variety of organic cations. It may play a significant role in the disposition of cationic neurotoxins and neurotransmitters in the brain.
Product Categories/Family for Slc22a3 blocking peptide
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
61kDa
NCBI Official Full Name
solute carrier family 22 member 3
NCBI Official Synonym Full Names
solute carrier family 22 (organic cation transporter), member 3
NCBI Official Symbol
Slc22a3
NCBI Official Synonym Symbols
EMT; Oct3; Orct3; Slca22a3
NCBI Protein Information
solute carrier family 22 member 3
UniProt Protein Name
Solute carrier family 22 member 3
Protein Family
UniProt Gene Name
Slc22a3
UniProt Synonym Gene Names
Oct3
UniProt Entry Name
S22A3_MOUSE
Research Articles on Slc22a3
Similar Products
Product Notes
The Slc22a3 slc22a3 (Catalog #AAA3232133) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The Slc22a3 Peptide - middle region reacts with Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's Slc22a3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the Slc22a3 slc22a3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: TSSELSCDPL TAFPNRSAPL VSCSGDWRYV ETHSTIVSQF DLVCSNAWML. It is sometimes possible for the material contained within the vial of "Slc22a3, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
