Sip1 blocking peptide
Sip1 Peptide - N-terminal region
Gene Names
Gemin2; Sip1; gemin-2
Reactivity
Mouse
Applications
Western Blot
Synonyms
Sip1; Sip1 Peptide - N-terminal region; Sip1 blocking peptide
Reactivity
Mouse
Form/Format
Lyophilized powder
Sequence
PRTPQEYLRRVQIEAAQCPDVVVAQIDPKKLKRKQSVNISLSGCQPAPEG
Sequence Length
269
Applicable Applications for Sip1 blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for Sip1 blocking peptide
The SMN complex plays an essential role in spliceosomal snRNP assembly in the cytoplasm and is required for pre-mRNA splicing in the nucleus.
Product Categories/Family for Sip1 blocking peptide
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
30kDa
NCBI Official Full Name
gem-associated protein 2
NCBI Official Synonym Full Names
gem nuclear organelle associated protein 2
NCBI Official Symbol
Gemin2
NCBI Official Synonym Symbols
Sip1; gemin-2
NCBI Protein Information
gem-associated protein 2
UniProt Protein Name
Gem-associated protein 2
Protein Family
UniProt Gene Name
Gemin2
UniProt Synonym Gene Names
Sip1; Gemin-2; SMN-interacting protein 1
UniProt Entry Name
GEMI2_MOUSE
NCBI Description
This gene encodes one of the proteins found in the survival of motor neuron (SMN) complex, which consists of the SMN protein and several gemin proteins. The SMN complex is localized to a subnuclear compartment called gems (gemini of coiled bodies) and is required for assembly of spliceosomal small nuclear ribonucleoproteins (snRNP) and for pre-mRNA splicing. This protein interacts directly with the SMN protein and it is required for formation of the SMN complex. Disruption of this gene in mouse resulted in impaired snRNP assembly, and motor neuron degeneration. [provided by RefSeq, Sep 2015]
Research Articles on Sip1
Similar Products
Product Notes
The Sip1 gemin2 (Catalog #AAA3230078) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The Sip1 Peptide - N-terminal region reacts with Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's Sip1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the Sip1 gemin2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: PRTPQEYLRR VQIEAAQCPD VVVAQIDPKK LKRKQSVNIS LSGCQPAPEG. It is sometimes possible for the material contained within the vial of "Sip1, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
