Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SCN2B blocking peptide

SCN2B Peptide - C-terminal region

Gene Names
Scn2b; Gm183; AI840361; 2810451E09Rik
Reactivity
Mouse
Synonyms
SCN2B; SCN2B Peptide - C-terminal region; SCN2B blocking peptide
Ordering
For Research Use Only!
Reactivity
Mouse
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: TVAVIVGASVGGFLAVVILVLMVVKCVRRKKEQKLSTDDLKTEEEGKMDG
Sequence Length
215
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for SCN2B blocking peptide
This is a synthetic peptide designed for use in combination with anti- SCN2B Antibody, made

Target Description: Crucial in the assembly, expression, and functional modulation of the heterotrimeric complex of the sodium channel. The subunit beta-2 causes an increase in the plasma membrane surface area and in its folding into microvilli. Interacts with TNR may play a crucial role in clustering and regulation of activity of sodium channels at nodes of Ranvier (By similarity).
Product Categories/Family for SCN2B blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
24 kDa
NCBI Official Full Name
sodium channel subunit beta-2
NCBI Official Synonym Full Names
sodium channel, voltage-gated, type II, beta
NCBI Official Symbol
Scn2b
NCBI Official Synonym Symbols
Gm183; AI840361; 2810451E09Rik
NCBI Protein Information
sodium channel subunit beta-2
UniProt Protein Name
Sodium channel subunit beta-2
Protein Family
UniProt Gene Name
Scn2b
UniProt Synonym Gene Names
Gm183
UniProt Entry Name
SCN2B_MOUSE

Uniprot Description

SCN2B: Crucial in the assembly, expression, and functional modulation of the heterotrimeric complex of the sodium channel. The subunit beta-2 causes an increase in the plasma membrane surface area and in its folding into microvilli. Interacts with TNR may play a crucial role in clustering and regulation of activity of sodium channels at nodes of Ranvier. Belongs to the sodium channel auxiliary subunit SCN2B (TC 8.A.17) family.

Protein type: Membrane protein, integral

Cellular Component: integral to membrane; membrane; voltage-gated sodium channel complex

Molecular Function: sodium channel activity; sodium channel regulator activity; voltage-gated ion channel activity; voltage-gated sodium channel activity

Biological Process: cardiac muscle contraction; ion transport; response to pyrethroid; sodium ion transport; transport

Research Articles on SCN2B

Similar Products

Product Notes

The SCN2B scn2b (Catalog #AAA3248343) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The SCN2B Peptide - C-terminal region reacts with Mouse and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: Synthetic peptide located within the following region: TVAVIVGASV GGFLAVVILV LMVVKCVRRK KEQKLSTDDL KTEEEGKMDG. It is sometimes possible for the material contained within the vial of "SCN2B, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.