GABARAPL1 blocking peptide
GABARAPL1 Peptide-N-terminal region
Reactivity
Mouse
Synonyms
GABARAPL1; GABARAPL1 Peptide-N-terminal region; GECI; Apg8l; Atg8l; AI196471; MNCb-0091; 3110025G09Rik; 9130422N19Rik; GABARAPL1 blocking peptide
Reactivity
Mouse
Form/Format
Lyophilized powder
Sequence
KFQYKEDHPFEYRKKEGEKIRKKYPDRVPVIVEKAPKARVPDLDKRKYLV
Quality Control
The peptide is characterized by mass spectroscopy
Protein Size
117 amino acids
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for GABARAPL1 blocking peptide
This is a synthetic peptide designed for use in combination with anti-GABARAPL1 Antibody. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Description of Target: Ubiquitin-like modifier that plays a role in intracellular transport of GABA(A) receptors and its interaction with the cytoskeleton. Involved in apoptosis. Involved in autophagy. Whereas LC3s are involved in elongation of the phagophore membrane, the GABARAP/GATE-16 subfamily is essential for a later stage in autophagosome maturation (By similarity).
Description of Target: Ubiquitin-like modifier that plays a role in intracellular transport of GABA(A) receptors and its interaction with the cytoskeleton. Involved in apoptosis. Involved in autophagy. Whereas LC3s are involved in elongation of the phagophore membrane, the GABARAP/GATE-16 subfamily is essential for a later stage in autophagosome maturation (By similarity).
NCBI and Uniprot Product Information
NCBI GeneID
UniProt Accession #
Molecular Weight
12kDa
UniProt Protein Name
Gamma-aminobutyric acid receptor-associated protein
Protein Family
UniProt Gene Name
Gabarap
UniProt Entry Name
GBRAP_MOUSE
Similar Products
Product Notes
The GABARAPL1 gabarap (Catalog #AAA3249439) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The GABARAPL1 Peptide-N-terminal region reacts with Mouse and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: KFQYKEDHPF EYRKKEGEKI RKKYPDRVPV IVEKAPKARV PDLDKRKYLV. It is sometimes possible for the material contained within the vial of "GABARAPL1, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
