Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

FLVCR1 blocking peptide

FLVCR1 Peptide - middle region

Gene Names
Flvcr1; FLVCR; Mfsd7b; 9630055N22Rik
Reactivity
Mouse
Applications
Western Blot
Synonyms
FLVCR1; FLVCR1 Peptide - middle region; FLVCR1 blocking peptide
Ordering
For Research Use Only!
Reactivity
Mouse
Form/Format
Lyophilized powder
Sequence
GPKEVSTACATAVLGNQLGTAVGFLLPPVLVPALGTQNSTGLLAHTQNNT
Sequence Length
560
Applicable Applications for FLVCR1 blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Product Categories/Family for FLVCR1 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
60kDa
NCBI Official Full Name
feline leukemia virus subgroup C receptor-related protein 1 isoform 1
NCBI Official Synonym Full Names
feline leukemia virus subgroup C cellular receptor 1
NCBI Official Symbol
Flvcr1
NCBI Official Synonym Symbols
FLVCR; Mfsd7b; 9630055N22Rik
NCBI Protein Information
feline leukemia virus subgroup C receptor-related protein 1
UniProt Protein Name
Feline leukemia virus subgroup C receptor-related protein 1
UniProt Gene Name
Flvcr1
UniProt Synonym Gene Names
Mfsd7b; Feline leukemia virus subgroup C receptor; Mfsd7b
UniProt Entry Name
FLVC1_MOUSE

Uniprot Description

FLVCR1: Heme transporter that exports cytoplasmic heme. It can also export coproporphyrin and protoporphyrin IX, which are both intermediate products in the heme biosynthetic pathway. Does not export bilirubin. Heme export depends on the presence of HPX and may be required to protect developing erythroid cells from heme toxicity. Heme export also provides protection from heme or ferrous iron toxicities in liver and brain. Causes susceptibility to FeLV-C in vitro. Defects in FLVCR1 are the cause of posterior column ataxia with retinitis pigmentosa (PCARP). A neurodegenerative syndrome beginning in infancy with areflexia and retinitis pigmentosa. Nyctalopia (night blindness) and peripheral visual field loss are usually evident during late childhood or teenage years, with subsequent progressive constriction of the visual fields and loss of central retinal function over time. A sensory ataxia caused by degeneration of the posterior columns of the spinal cord results in a loss of proprioceptive sensation that is clinically evident in the second decade of life and gradually progresses. Scoliosis, camptodactyly, achalasia, gastrointestinal dysmotility, and a sensory peripheral neuropathy are variable features of the disease. Affected individuals have no clinical or radiological evidence of cerebral or cerebellar involvement. Defective neuronal heme transmembrane export due to FLVCR1 mutations may abrogate the neuroprotective effects of neuroglobin and initiate an apoptotic cascade that results in the selective degeneration of photoreceptors in the neurosensory retina and sensory neurons in the posterior spinal cord. Belongs to the major facilitator superfamily. Feline leukemia virus subgroup C receptor (TC 2.A.1.28.1) family.

Protein type: Transporter; Transporter, ion channel; Transporter, iron; Membrane protein, integral; Membrane protein, multi-pass

Cellular Component: membrane; mitochondrion; integral to membrane; plasma membrane

Molecular Function: heme transporter activity

Biological Process: spleen development; blood vessel development; heme transport; erythrocyte maturation; in utero embryonic development; multicellular organism growth; regulation of organ growth; limb morphogenesis; mitochondrial transport; embryonic skeletal morphogenesis; transport; erythrocyte differentiation; embryonic digit morphogenesis; transmembrane transport

Research Articles on FLVCR1

Similar Products

Product Notes

The FLVCR1 flvcr1 (Catalog #AAA3236920) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The FLVCR1 Peptide - middle region reacts with Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's FLVCR1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the FLVCR1 flvcr1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: GPKEVSTACA TAVLGNQLGT AVGFLLPPVL VPALGTQNST GLLAHTQNNT. It is sometimes possible for the material contained within the vial of "FLVCR1, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.