Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: FLVCR1Sample Tissue: Human Hela Whole CellAntibody Dilution: 1.0ug/ml)

Rabbit anti-Human FLVCR1 Polyclonal Antibody | anti-FLVCR1 antibody

FLVCR1 Antibody - C-terminal region

Gene Names
FLVCR1; PCA; AXPC1; FLVCR; PCARP; MFSD7B; SLC49A1
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
FLVCR1; Polyclonal Antibody; FLVCR1 Antibody - C-terminal region; anti-FLVCR1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: VWMFIGIILTALIKSDLRRHNINIGITNVDVKAIPADSPTDQEPKTVMLS
Sequence Length
555
Applicable Applications for anti-FLVCR1 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human FLVCR1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: FLVCR1Sample Tissue: Human Hela Whole CellAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: FLVCR1Sample Tissue: Human Hela Whole CellAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-FLVCR1 antibody
This gene encodes a member of the major facilitator superfamily of transporter proteins. The encoded protein is a heme transporter that may play a critical role in erythropoiesis by protecting developing erythroid cells from heme toxicity. This gene may play a role in posterior column ataxia with retinitis pigmentosa and the hematological disorder Diamond-Blackfan syndrome.
Product Categories/Family for anti-FLVCR1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
60 kDa
NCBI Official Full Name
feline leukemia virus subgroup C receptor-related protein 1
NCBI Official Synonym Full Names
feline leukemia virus subgroup C cellular receptor 1
NCBI Official Symbol
FLVCR1
NCBI Official Synonym Symbols
PCA; AXPC1; FLVCR; PCARP; MFSD7B; SLC49A1
NCBI Protein Information
feline leukemia virus subgroup C receptor-related protein 1
UniProt Protein Name
Feline leukemia virus subgroup C receptor-related protein 1
UniProt Gene Name
FLVCR1
UniProt Synonym Gene Names
FLVCR
UniProt Entry Name
FLVC1_HUMAN

NCBI Description

This gene encodes a member of the major facilitator superfamily of transporter proteins. The encoded protein is a heme transporter that may play a critical role in erythropoiesis by protecting developing erythroid cells from heme toxicity. This gene may play a role in posterior column ataxia with retinitis pigmentosa and the hematological disorder Diamond-Blackfan syndrome. [provided by RefSeq, Jan 2011]

Research Articles on FLVCR1

Similar Products

Product Notes

The FLVCR1 flvcr1 (Catalog #AAA3220885) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The FLVCR1 Antibody - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's FLVCR1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the FLVCR1 flvcr1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: VWMFIGIILT ALIKSDLRRH NINIGITNVD VKAIPADSPT DQEPKTVMLS. It is sometimes possible for the material contained within the vial of "FLVCR1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.