Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

FABP7 blocking peptide

FABP7 Peptide - middle region

Gene Names
Fabp7; MRG; Blbp; BFABP; B-FABP
Reactivity
Mouse
Synonyms
FABP7; FABP7 Peptide - middle region; FABP7 blocking peptide
Ordering
For Research Use Only!
Reactivity
Mouse
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: ALGVGFATRQVGNVTKPTVIISQEGGKVVIRTQCTFKNTEINFQLGEEFE
Sequence Length
132
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for FABP7 blocking peptide
This is a synthetic peptide designed for use in combination with anti- FABP7 Antibody, made

Target Description: B-FABP could be involved in the transport of a so far unknown hydrophobic ligand with potential morphogenic activity during CNS development. It is required for the establishment of the radial glial fiber system in developing brain, a system that is necessary for the migration of immature neurons to establish cortical layers.
Product Categories/Family for FABP7 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
14 kDa
NCBI Official Full Name
fatty acid-binding protein, brain
NCBI Official Synonym Full Names
fatty acid binding protein 7, brain
NCBI Official Symbol
Fabp7
NCBI Official Synonym Symbols
MRG; Blbp; BFABP; B-FABP
NCBI Protein Information
fatty acid-binding protein, brain
UniProt Protein Name
Fatty acid-binding protein, brain
UniProt Gene Name
Fabp7
UniProt Synonym Gene Names
Blbp; BLBP; B-FABP

Uniprot Description

FABP7: B-FABP could be involved in the transport of a so far unknown hydrophobic ligand with potential morphogenic activity during CNS development. It is required for the establishment of the radial glial fiber system in developing brain, a system that is necessary for the migration of immature neurons to establish cortical layers. Belongs to the calycin superfamily. Fatty-acid binding protein (FABP) family.

Protein type: Cell cycle regulation; Cell development/differentiation; Lipid-binding

Chromosomal Location of Human Ortholog: 10|10 B4

Cellular Component: cell projection; cell soma; cytoplasm; cytosol; intercellular junction; nucleoplasm; nucleus

Molecular Function: fatty acid binding; lipid binding; transporter activity

Biological Process: cell proliferation in forebrain; epithelial cell proliferation; neurogenesis; prepulse inhibition; startle response; transport

Research Articles on FABP7

Similar Products

Product Notes

The FABP7 fabp7 (Catalog #AAA3248303) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The FABP7 Peptide - middle region reacts with Mouse and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: Synthetic peptide located within the following region: ALGVGFATRQ VGNVTKPTVI ISQEGGKVVI RTQCTFKNTE INFQLGEEFE. It is sometimes possible for the material contained within the vial of "FABP7, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.