CHRNA5 blocking peptide
CHRNA5 Peptide - middle region
Gene Names
Chrna5; Acra5; Acra-5
Reactivity
Mouse
Synonyms
CHRNA5; CHRNA5 Peptide - middle region; CHRNA5 blocking peptide
Reactivity
Mouse
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: KIKFGLAISQLVDVDEKNQLMTTNVWLKQEWIDVKLRWNPDDYGGIKIIR
Sequence Length
438
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for CHRNA5 blocking peptide
This is a synthetic peptide designed for use in combination with anti- CHRNA5 Antibody, made
Target Description: After binding acetylcholine, the AChR responds by an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane.
Target Description: After binding acetylcholine, the AChR responds by an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane.
Product Categories/Family for CHRNA5 blocking peptide
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
48 kDa
NCBI Official Full Name
neuronal acetylcholine receptor subunit alpha-5
NCBI Official Synonym Full Names
cholinergic receptor, nicotinic, alpha polypeptide 5
NCBI Official Symbol
Chrna5
NCBI Official Synonym Symbols
Acra5; Acra-5
NCBI Protein Information
neuronal acetylcholine receptor subunit alpha-5
UniProt Protein Name
Neuronal acetylcholine receptor subunit alpha-5
Protein Family
UniProt Gene Name
Chrna5
UniProt Entry Name
ACHA5_MOUSE
Research Articles on CHRNA5
Similar Products
Product Notes
The CHRNA5 chrna5 (Catalog #AAA3248281) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The CHRNA5 Peptide - middle region reacts with Mouse and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: Synthetic peptide located within the following region: KIKFGLAISQ LVDVDEKNQL MTTNVWLKQE WIDVKLRWNP DDYGGIKIIR. It is sometimes possible for the material contained within the vial of "CHRNA5, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
