Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Ccbe1 blocking peptide

Ccbe1 Peptide - C-terminal region

Gene Names
Ccbe1; mKIAA1983; 4933426F18Rik; 9430093N24Rik
Reactivity
Mouse
Applications
Western Blot
Synonyms
Ccbe1; Ccbe1 Peptide - C-terminal region; Ccbe1 blocking peptide
Ordering
For Research Use Only!
Reactivity
Mouse
Form/Format
Lyophilized powder
Sequence
RGAPGPPGSPGPPGSFDFLLLVLADIRNDIAELQEKVFGHRTHSSAEDFP
Sequence Length
408
Applicable Applications for Ccbe1 blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for Ccbe1 blocking peptide
This is a synthetic peptide designed for use in combination with anti-Ccbe1 Antibody, made

Target Description: Ccbe1 is required for lymphangioblast budding and angiogenic sprouting from venous endothelium during embryogenesis.
Product Categories/Family for Ccbe1 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
45kDa
NCBI Official Full Name
collagen and calcium-binding EGF domain-containing protein 1
NCBI Official Synonym Full Names
collagen and calcium binding EGF domains 1
NCBI Official Symbol
Ccbe1
NCBI Official Synonym Symbols
mKIAA1983; 4933426F18Rik; 9430093N24Rik
NCBI Protein Information
collagen and calcium-binding EGF domain-containing protein 1
UniProt Protein Name
Collagen and calcium-binding EGF domain-containing protein 1
UniProt Gene Name
Ccbe1
UniProt Synonym Gene Names
Kiaa1983
UniProt Entry Name
CCBE1_MOUSE

Uniprot Description

CCBE1: Required for lymphangioblast budding and angiogenic sprouting from venous endothelium during embryogenesis. Defects in CCBE1 are the cause of Hennekam lymphangiectasia-lymphedema syndrome (HLLS). HLLS is a generalized lymph-vessels dysplasia characterized by intestinal lymphangiectasia with severe lymphedema of the limbs, genitalia and face. In addition, affected individuals have unusual facies and severe mental retardation. Belongs to the CCBE1 family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Secreted, signal peptide; Secreted

Cellular Component: proteinaceous extracellular matrix; extracellular space; collagen; extracellular region

Molecular Function: collagen binding; protease binding; calcium ion binding

Biological Process: positive regulation of angiogenesis; multicellular organismal development; lymphangiogenesis; angiogenesis

Research Articles on Ccbe1

Similar Products

Product Notes

The Ccbe1 ccbe1 (Catalog #AAA3235808) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The Ccbe1 Peptide - C-terminal region reacts with Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's Ccbe1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the Ccbe1 ccbe1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: RGAPGPPGSP GPPGSFDFLL LVLADIRNDI AELQEKVFGH RTHSSAEDFP. It is sometimes possible for the material contained within the vial of "Ccbe1, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.