Atp5o blocking peptide
Atp5o Peptide - N-terminal region
Gene Names
Atp5o; ATPO; OSCP; Atp5po; D12Wsu28e
Reactivity
Mouse
Applications
Western Blot
Synonyms
Atp5o; Atp5o Peptide - N-terminal region; Atp5o blocking peptide
Reactivity
Mouse
Form/Format
Lyophilized powder
Sequence
FSTSVVRPFAKLVRPPVQVYGIEGRYATALYSAASKEKKLDQVEKELLRV
Sequence Length
213
Applicable Applications for Atp5o blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for Atp5o blocking peptide
This is a synthetic peptide designed for use in combination with anti-Atp5o Antibody, made
Target Description: Mitochondrial membrane ATP synthase (F1F0 ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F1 - containing the extramembraneous catalytic core and F0 - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F1 is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Part of the complex F0 domain and the peripheric stalk, which acts as a stator to hold the catalytic alpha3beta3 subcomplex and subunit a/ATP6 static relative to the rotary elements.
Target Description: Mitochondrial membrane ATP synthase (F1F0 ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F1 - containing the extramembraneous catalytic core and F0 - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F1 is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Part of the complex F0 domain and the peripheric stalk, which acts as a stator to hold the catalytic alpha3beta3 subcomplex and subunit a/ATP6 static relative to the rotary elements.
Product Categories/Family for Atp5o blocking peptide
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
23kDa
NCBI Official Full Name
ATP synthase subunit O, mitochondrial
NCBI Official Synonym Full Names
ATP synthase, H+ transporting, mitochondrial F1 complex, O subunit
NCBI Official Symbol
Atp5o
NCBI Official Synonym Symbols
ATPO; OSCP; Atp5po; D12Wsu28e
NCBI Protein Information
ATP synthase subunit O, mitochondrial
UniProt Protein Name
ATP synthase subunit O, mitochondrial
UniProt Gene Name
Atp5o
UniProt Synonym Gene Names
D12Wsu28e; OSCP
UniProt Entry Name
ATPO_MOUSE
Research Articles on Atp5o
Similar Products
Product Notes
The Atp5o atp5o (Catalog #AAA3232886) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The Atp5o Peptide - N-terminal region reacts with Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's Atp5o can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the Atp5o atp5o for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: FSTSVVRPFA KLVRPPVQVY GIEGRYATAL YSAASKEKKL DQVEKELLRV. It is sometimes possible for the material contained within the vial of "Atp5o, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
