Western Blot (WB)
(WB Suggested Anti-Atp5f1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Mouse Heart)
Rabbit Atp5f1 Polyclonal Antibody | anti-ATP5F1 antibody
Atp5f1 antibody - N-terminal region
Gene Names
Atp5f1; Atp5pb; C76477
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
Atp5f1; Polyclonal Antibody; Atp5f1 antibody - N-terminal region; anti-ATP5F1 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: PPLPEYGGKVRLGLIPEEFFQFLYPKTGVTGPYVLGTGLSLYFLSKEIYV
Sequence Length
256
Applicable Applications for anti-ATP5F1 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 93%; Rat: 100%; Zebrafish: 93%
Immunogen
The immunogen is a synthetic peptide corresponding to a region of Mouse
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-Atp5f1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Mouse Heart)
Western Blot (WB)
(WB Suggested Anti-Atp5f1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Mouse Heart)
Related Product Information for anti-ATP5F1 antibody
This is a rabbit polyclonal antibody against Atp5f1. It was validated on Western Blot
Target Description: Mitochondrial membrane ATP synthase (F1F0 ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F1 - containing the extramembraneous catalytic core, and F0 - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F1 is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Part of the complex F0 domain and the peripheric stalk, which acts as a stator to hold the catalytic alpha3beta3 subcomplex and subunit a/ATP6 static relative to the rotary elements.
Target Description: Mitochondrial membrane ATP synthase (F1F0 ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F1 - containing the extramembraneous catalytic core, and F0 - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F1 is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Part of the complex F0 domain and the peripheric stalk, which acts as a stator to hold the catalytic alpha3beta3 subcomplex and subunit a/ATP6 static relative to the rotary elements.
Product Categories/Family for anti-ATP5F1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
29kDa
NCBI Official Full Name
ATP synthase F(0) complex subunit B1, mitochondrial isoform 1
NCBI Official Synonym Full Names
ATP synthase, H+ transporting, mitochondrial F0 complex, subunit B1
NCBI Official Symbol
Atp5f1
NCBI Official Synonym Symbols
Atp5pb; C76477
NCBI Protein Information
ATP synthase F(0) complex subunit B1, mitochondrial
UniProt Protein Name
ATP synthase F(0) complex subunit B1, mitochondrial
Protein Family
UniProt Gene Name
Atp5f1
UniProt Synonym Gene Names
ATPase subunit b
UniProt Entry Name
AT5F1_MOUSE
Similar Products
Product Notes
The ATP5F1 atp5f1 (Catalog #AAA3208907) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Atp5f1 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's Atp5f1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ATP5F1 atp5f1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: PPLPEYGGKV RLGLIPEEFF QFLYPKTGVT GPYVLGTGLS LYFLSKEIYV. It is sometimes possible for the material contained within the vial of "Atp5f1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
