ARL6IP5 blocking peptide
ARL6IP5 Antibody - N-terminal region
Gene Names
Arl6ip5; Aip-5; AV001879; addiscin; Gtrap3-18; 5930404D22Rik
Reactivity
Mouse
Applications
Western Blot
Synonyms
ARL6IP5; ARL6IP5 Antibody - N-terminal region; ARL6IP5 blocking peptide
Reactivity
Mouse
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: MDVNLAPLRAWDDFFPGSDRFARPDFRDISKWNNRVVSNLLYYQTNYLVV
Sequence Length
188
Applicable Applications for ARL6IP5 blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for ARL6IP5 blocking peptide
This is a synthetic peptide designed for use in combination with anti-ARL6IP5, made
Product Categories/Family for ARL6IP5 blocking peptide
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
22 kDa
NCBI Official Full Name
PRA1 family protein 3
NCBI Official Synonym Full Names
ADP-ribosylation factor-like 6 interacting protein 5
NCBI Official Symbol
Arl6ip5
NCBI Official Synonym Symbols
Aip-5; AV001879; addiscin; Gtrap3-18; 5930404D22Rik
NCBI Protein Information
PRA1 family protein 3
UniProt Protein Name
PRA1 family protein 3
Protein Family
UniProt Gene Name
Arl6ip5
UniProt Synonym Gene Names
Aip5; Jwa; Pra2; Praf3; ARL-6-interacting protein 5; Aip-5
UniProt Entry Name
PRAF3_MOUSE
Uniprot Description
ARL6IP5: Regulates intracellular concentrations of taurine and glutamate. Negatively modulates SLC1A1/EAAC1 glutamate transport activity by decreasing its affinity for glutamate. May be involved in membrane traffic. Belongs to the PRA1 family.
Protein type: Membrane protein, integral; Endoplasmic reticulum; Cytoskeletal; Membrane protein, multi-pass
Cellular Component: cytoskeleton; membrane; endoplasmic reticulum; cytoplasm; integral to membrane
Molecular Function: protein C-terminus binding; protein binding
Biological Process: L-glutamate transport; positive regulation of apoptosis; positive regulation of caspase activity; negative regulation of transport; induction of apoptosis by oxidative stress; positive regulation of stress-activated MAPK cascade
Research Articles on ARL6IP5
Similar Products
Product Notes
The ARL6IP5 arl6ip5 (Catalog #AAA3245341) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The ARL6IP5 Antibody - N-terminal region reacts with Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's ARL6IP5 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ARL6IP5 arl6ip5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MDVNLAPLRA WDDFFPGSDR FARPDFRDIS KWNNRVVSNL LYYQTNYLVV. It is sometimes possible for the material contained within the vial of "ARL6IP5, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
